You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09191
Secondary Accession Numbers
  • 14949
Name Ketosamine-3-kinase
Synonyms
  1. FN3K-RP
  2. FN3K-related protein
  3. Fructosamine-3-kinase-related protein
Gene Name FN3KRP
Protein Type Enzyme
Biological Properties
General Function Carbohydrate transport and metabolism
Specific Function Phosphorylates psicosamines and ribulosamines, but not fructosamines, on the third carbon of the sugar moiety. Protein- bound psicosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 17q25.3
SNPs FN3KRP
Gene Sequence
>930 bp
ATGGAGGAGCTGCTGAGGCGCGAGCTGGGCTGCAGCTCTGTCAGGGCCACGGGCCACTCG
GGGGGCGGGTGCATCAGCCAGGGCCGGAGCTACGACACGGATCAAGGACGAGTGTTCGTG
AAAGTGAACCCCAAGGCGGAGGCCAGAAGAATGTTTGAAGGTGAGATGGCAAGTTTAACT
GCCATCCTGAAAACAAACACGGTGAAAGTGCCCAAGCCCATCAAGGTTCTGGATGCCCCA
GGCGGCGGGAGCGTGCTGGTGATGGAGCACATGGACATGAGGCATCTGAGCAGTCATGCT
GCAAAGCTTGGAGCCCAGCTGGCCGATTTACACCTTGATAACAAGAAGCTTGGAGAGATG
CGCCTGAAGGAGGCGGGCACAGTGGGGAGAGGAGGTGGGCAGGAGGAACGGCCCTTTGTG
GCCCGGTTTGGATTTGACGTGGTGACGTGCTGTGGATACCTCCCCCAGGTGAATGACTGG
CAGGAGGACTGGGTCGTGTTCTATGCCCGGCAGCGCATTCAGCCCCAGATGGACATGGTG
GAGAAGGAGTCTGGGGACAGGGAGGCCCTCCAGCTTTGGTCTGCTCTGCAGTTAAAGATC
CCTGACCTGTTCCGTGACCTGGAGATCATCCCAGCCTTACTCCACGGGGACCTCTGGGGT
GGAAACGTAGCAGAGGATTCCTCTGGGCCGGTGATTTTTGACCCAGCTTCTTTCTACGGC
CACTCGGAATATGAGCTGGCAATAGCTGGCATGTTTGGGGGCTTTAGCAGCTCCTTTTAC
TCCGCCTACCACGGCAAAATCCCCAAGGCCCCAGGATTCGAGAAGCGCCTTCGGTTGTAT
CAGCTCTTTCACTACTTGAACCACTGGAATCATTTTGGATCGGGGTACAGAGGATCCTCC
CTGAACATCATGAGGAATCTGGTCAAGTGA
Protein Properties
Number of Residues 309
Molecular Weight 34412.0
Theoretical pI 7.36
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ketosamine-3-kinase
MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARRMFEGEMASLT
AILKTNTVKVPKPIKVLDAPGGGSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEM
RLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMDMV
EKESGDREALQLWSALQLKIPDLFRDLEIIPALLHGDLWGGNVAEDSSGPVIFDPASFYG
HSEYELAIAGMFGGFSSSFYSAYHGKIPKAPGFEKRLQLYQLFHYLNHWNHFGSGYRGSS
LNIMRNLVK
GenBank ID Protein 10433586
UniProtKB/Swiss-Prot ID Q9HA64
UniProtKB/Swiss-Prot Entry Name KT3K_HUMAN
PDB IDs Not Available
GenBank Gene ID AK022233
GeneCard ID FN3KRP
GenAtlas ID FN3KRP
HGNC ID HGNC:25700
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  5. Collard F, Delpierre G, Stroobant V, Matthijs G, Van Schaftingen E: A mammalian protein homologous to fructosamine-3-kinase is a ketosamine-3-kinase acting on psicosamines and ribulosamines but not on fructosamines. Diabetes. 2003 Dec;52(12):2888-95. [PubMed:14633848 ]
  6. Collard F, Wiame E, Bergans N, Fortpied J, Vertommen D, Vanstapel F, Delpierre G, Van Schaftingen E: Fructosamine 3-kinase-related protein and deglycation in human erythrocytes. Biochem J. 2004 Aug 15;382(Pt 1):137-43. [PubMed:15137908 ]