Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09192
Secondary Accession Numbers
  • 14950
Name G/T mismatch-specific thymine DNA glycosylase
Synonyms
  1. Thymine-DNA glycosylase
Gene Name TDG
Protein Type Enzyme
Biological Properties
General Function Involved in hydrolase activity, hydrolyzing N-glycosyl compounds
Specific Function In the DNA of higher eukaryotes, hydrolytic deamination of 5-methylcytosine to thymine leads to the formation of G/T mismatches. This enzyme corrects G/T mispairs to G/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar- phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing n-glycosyl compounds
nucleic acid binding
dna binding
structure-specific dna binding
double-stranded dna binding
mismatched dna binding
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
dna metabolic process
dna repair
mismatch repair
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 12q24.1
SNPs TDG
Gene Sequence
>1233 bp
ATGGAAGCGGAGAACGCGGGCAGCTATTCCCTTCAGCAAGCTCAAGCTTTTTATACGTTT
CCATTTCAACAACTGATGGCTGAAGCTCCTAATATGGCAGTTGTGAATGAACAGCAAATG
CCAGAAGAAGTTCCAGCCCCAGCTCCTGCTCAGGAACCAGTGCAAGAGGCTCCAAAAGGA
AGAAAAAGAAAACCCAGAACAACAGAACCAAAACAACCAGTGGAACCCAAAAAACCTGTT
GAGTCAAAAAAATCTGGCAAGTCTGCAAAATCAAAAGAAAAACAAGAAAAAATTACAGAC
ACATTTAAAGTAAAAAGAAAAGTAGACCGTTTTAATGGTGTTTCAGAAGCTGAACTTCTG
ACCAAGACTCTCCCCGATATTTTGACCTTCAATCTGGACATTGTCATTATTGGCATAAAC
CCGGGACTAATGGCTGCTTACAAAGGGCATCATTACCCTGGACCTGGAAACCATTTTTGG
AAGTGTTTGTTTATGTCAGGGCTCAGTGAGGTCCAGCTGAACCATATGGATGATCACACT
CTACCAGGGAAGTATGGTATTGGATTTACCAACATGGTGGAAAGGACCACGCCCGGCAGC
AAAGATCTCTCCAGTAAAGAATTTCGTGAAGGAGGACGTATTCTAGTACAGAAATTACAG
AAATATCAGCCACGAATAGCAGTGTTTAATGGAAAATGTATTTATGAAATTTTTAGTAAA
GAAGTTTTTGGAGTAAAGGTTAAGAACTTGGAATTTGGGCTTCAGCCCCATAAGATTCCA
GACACAGAAACTCTCTGCTATGTTATGCCATCATCCAGTGCAAGATGTGCTCAGTTTCCT
CGAGCCCAAGACAAAGTTCATTACTACATAAAACTGAAGGACTTAAGAGATCAGTTGAAA
GGCATTGAACGAAATATGGACGTTCAAGAGGTGCAATATACATTTGACCTACAGCTTGCC
CAAGAGGATGCAAAGAAGATGGCTGTTAAGGAAGAAAAATATGATCCAGGTTATGAGGCA
GCATATGGTGGTGCTTACGGAGAAAATCCATGCAGCAGTGAACCTTGTGGCTTCTCTTCA
AATGGGCTAATTGAGAGCGTGGAGTTAAGAGGAGAATCAGCTTTCAGTGGCATTCCTAAT
GGGCAGTGGATGACCCAGTCATTTACAGACCAAATTCCTTCCTTTAGTAATCACTGTGGA
ACACAAGAACAGGAAGAAGAAAGCCATGCTTAA
Protein Properties
Number of Residues 410
Molecular Weight 46053.0
Theoretical pI 6.79
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>G/T mismatch-specific thymine DNA glycosylase
MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKG
RKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELL
TKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHT
LPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSK
EVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK
GIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSS
NGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA
GenBank ID Protein 23267188
UniProtKB/Swiss-Prot ID Q13569
UniProtKB/Swiss-Prot Entry Name TDG_HUMAN
PDB IDs Not Available
GenBank Gene ID AF545435
GeneCard ID TDG
GenAtlas ID TDG
HGNC ID HGNC:11700
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Neddermann P, Gallinari P, Lettieri T, Schmid D, Truong O, Hsuan JJ, Wiebauer K, Jiricny J: Cloning and expression of human G/T mismatch-specific thymine-DNA glycosylase. J Biol Chem. 1996 May 31;271(22):12767-74. [PubMed:8662714 ]
  3. Neddermann P, Jiricny J: Efficient removal of uracil from G.U mispairs by the mismatch-specific thymine DNA glycosylase from HeLa cells. Proc Natl Acad Sci U S A. 1994 Mar 1;91(5):1642-6. [PubMed:8127859 ]
  4. Neddermann P, Jiricny J: The purification of a mismatch-specific thymine-DNA glycosylase from HeLa cells. J Biol Chem. 1993 Oct 5;268(28):21218-24. [PubMed:8407958 ]
  5. Hardeland U, Steinacher R, Jiricny J, Schar P: Modification of the human thymine-DNA glycosylase by ubiquitin-like proteins facilitates enzymatic turnover. EMBO J. 2002 Mar 15;21(6):1456-64. [PubMed:11889051 ]
  6. Baba D, Maita N, Jee JG, Uchimura Y, Saitoh H, Sugasawa K, Hanaoka F, Tochio H, Hiroaki H, Shirakawa M: Crystal structure of thymine DNA glycosylase conjugated to SUMO-1. Nature. 2005 Jun 16;435(7044):979-82. [PubMed:15959518 ]
  7. Baba D, Maita N, Jee JG, Uchimura Y, Saitoh H, Sugasawa K, Hanaoka F, Tochio H, Hiroaki H, Shirakawa M: Crystal structure of SUMO-3-modified thymine-DNA glycosylase. J Mol Biol. 2006 May 26;359(1):137-47. Epub 2006 Mar 31. [PubMed:16626738 ]