Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09193
Secondary Accession Numbers
  • 14951
Name Deoxyhypusine hydroxylase
Synonyms
  1. Deoxyhypusine dioxygenase
  2. Deoxyhypusine monooxygenase
  3. HEAT-like repeat-containing protein 1
  4. hDOHH
Gene Name DOHH
Protein Type Enzyme
Biological Properties
General Function Involved in binding
Specific Function Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate to form hypusine, an essential post-translational modification only found in mature eIF-5A factor.
Pathways
  • eIF5A hypusination
Reactions
Protein N(6)-(4-aminobutyl)-L-lysine + AH(2) + Oxygen → protein N(6)-((R)-4-amino-2-hydroxybutyl)-L-lysine + A + Water details
GO Classification
Biological Process
post-translational protein modification
peptidyl-lysine modification to hypusine
Cellular Component
cytosol
Function
binding
Molecular Function
metal ion binding
deoxyhypusine monooxygenase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19p13.3
SNPs DOHH
Gene Sequence
>909 bp
ATGGTGACGGAGCAGGAGGTGGATGCCATCGGGCAGACGCTGGTGGACCCCAAGCAGCCC
CTGCAGGCCCGCTTCCGGGCGCTGTTCACGCTGCGTGGGCTCGGCGGCCCAGGCGCCATT
GCATGGATCAGCCAGGCCTTCGATGACGATTCCGCCCTGCTCAAGCACGAGCTGGCCTAC
TGCCTGGGCCAGATGCAGGATGCCCGCGCCATCCCCATGCTGGTGGACGTGCTGCAAGAC
ACCCGTCAGGAGCCCATGGTGCGCCATGAGGCAGGGGAGGCCCTGGGGGCCATCGGGGAC
CCGGAAGTTCTGGAGATCCTGAAGCAGTATTCCTCGGACCCCGTCATCGAGGTGGCCGAG
ACCTGCCAGCTGGCCGTGCGCAGGCTGGAGTGGCTGCAGCAGCACGGCGGGGAGCCGGCG
GCGGGACCCTACCTCTCCGTGGACCCTGCCCCGCCGGCTGAGGAGCGTGACGTGGGGCGC
CTGCGGGAGGCGCTGCTGGATGAGTCCCGGCCGCTCTTCGAGCGATACCGCGCCATGTTC
GCCCTGCGCAACGCGGGAGGCGAGGAGGCCGCCCTGGCGCTGGCCGAGGGTCTGCACTGT
GGGAGCGCCCTCTTCCGCCACGAGGTCGGCTACGTCCTGGGACAGCTGCAGCACGAGGCG
GCGGTGCCCCAGCTGGCGGCCGCCCTGGCCCGATGCACCGAGAACCCCATGGTGCGGCAC
GAGTGCGCGGAGGCCCTGGGCGCCATTGCCCGGCCCGCCTGCCTGGCCGCGCTGCAGGCT
CACGCGGACGACCCAGAGCGCGTGGTGCGTGAGAGCTGCGAGGTGGCTCTGGACATGTAT
GAGCACGAGACCGGGCGGGCCTTCCAGTACGCGGACGGCCTGGAGCAGCTGCGCGGGGCC
CCCTCCTAG
Protein Properties
Number of Residues 302
Molecular Weight 32903.885
Theoretical pI 4.822
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Deoxyhypusine hydroxylase
MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAY
CLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAE
TCQLAVRRLEWLQQHGGEPAAGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMF
ALRNAGGEEAALALAEGLHCGSALFRHEVGYVLGQLQHEAAVPQLAAALARCTENPMVRH
ECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMYEHETGRAFQYADGLEQLRGA
PS
GenBank ID Protein 223633884
UniProtKB/Swiss-Prot ID Q9BU89
UniProtKB/Swiss-Prot Entry Name DOHH_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001145165.1
GeneCard ID DOHH
GenAtlas ID DOHH
HGNC ID HGNC:28662
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Kim YS, Kang KR, Wolff EC, Bell JK, McPhie P, Park MH: Deoxyhypusine hydroxylase is a Fe(II)-dependent, HEAT-repeat enzyme. Identification of amino acid residues critical for Fe(II) binding and catalysis [corrected]. J Biol Chem. 2006 May 12;281(19):13217-25. Epub 2006 Mar 13. [PubMed:16533814 ]
  4. Park JH, Aravind L, Wolff EC, Kaevel J, Kim YS, Park MH: Molecular cloning, expression, and structural prediction of deoxyhypusine hydroxylase: a HEAT-repeat-containing metalloenzyme. Proc Natl Acad Sci U S A. 2006 Jan 3;103(1):51-6. Epub 2005 Dec 21. [PubMed:16371467 ]
  5. Vu VV, Emerson JP, Martinho M, Kim YS, Munck E, Park MH, Que L Jr: Human deoxyhypusine hydroxylase, an enzyme involved in regulating cell growth, activates O2 with a nonheme diiron center. Proc Natl Acad Sci U S A. 2009 Sep 1;106(35):14814-9. doi: 10.1073/pnas.0904553106. Epub 2009 Aug 19. [PubMed:19706422 ]