You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09206
Secondary Accession Numbers
  • 14988
Name Disintegrin and metalloproteinase domain-containing protein 9
Synonyms
  1. ADAM 9
  2. Cellular disintegrin-related protein
  3. Meltrin-gamma
  4. Metalloprotease/disintegrin/cysteine-rich protein 9
  5. Myeloma cell metalloproteinase
Gene Name ADAM9
Protein Type Enzyme
Biological Properties
General Function Involved in metalloendopeptidase activity
Specific Function Probable zinc protease. May mediate cell-cell or cell- matrix interactions. Isoform 2 displays alpha-secretase activity for APP
Pathways Not Available
Reactions Not Available
GO Classification
Function
endopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
metalloendopeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Isoform 2:Secreted
Gene Properties
Chromosome Location Chromosome:8
Locus 8p11.22
SNPs ADAM9
Gene Sequence
>2460 bp
ATGGGGTCTGGCGCGCGCTTTCCCTCGGGGACCCTTCGTGTCCGGTGGTTGCTGTTGCTT
GGCCTGGTGGGCCCAGTCCTCGGTGCGGCGCGGCCAGGCTTTCAACAGACCTCACATCTT
TCTTCTTATGAAATTATAACTCCTTGGAGATTAACTAGAGAAAGAAGAGAAGCCCCTAGG
CCCTATTCAAAACAAGTATCTTATGTTATTCAGGCTGAAGGAAAAGAGCATATTATTCAC
TTGGAAAGGAACAAAGACCTTTTGCCTGAAGATTTTGTGGTTTATACTTACAACAAGGAA
GGGACTTTAATCACTGACCATCCCAATATACAGAATCATTGTCATTATCGGGGCTATGTG
GAGGGAGTTCATAATTCATCCATTGCTCTTAGCGACTGTTTTGGACTCAGAGGATTGCTG
CATTTAGAGAATGCGAGTTATGGGATTGAACCCCTGCAGAACAGCTCTCATTTTGAGCAC
ATCATTTATCGAATGGATGATGTCTACAAAGAGCCTCTGAAATGTGGAGTTTCCAACAAG
GATATAGAGAAAGAAACTGCAAAGGATGAAGAGGAAGAGCCTCCCAGCATGACTCAGCTA
CTTCGAAGAAGAAGAGCTGTCTTGCCACAGACCCGGTATGTGGAGCTGTTCATTGTCGTA
GACAAGGAAAGGTATGACATGATGGGAAGAAATCAGACTGCTGTGAGAGAAGAGATGATT
CTCCTGGCAAACTACTTGGATAGTATGTATATTATGTTAAATATTCGAATTGTGCTAGTT
GGACTGGAGATTTGGACCAATGGAAACCTGATCAACATAGTTGGGGGTGCTGGTGATGTG
CTGGGGAACTTCGTGCAGTGGCGGGAAAAGTTTCTTATCACACGTCGGAGACATGACAGT
GCACAGCTAGTTCTAAAGAAAGGTTTTGGTGGAACTGCAGGAATGGCATTTGTGGGAACA
GTGTGTTCAAGGAGCCACGCAGGCGGGATTAATGTGTTTGGACAAATCACTGTGGAGACA
TTTGCTTCCATTGTTGCTCATGAATTGGGTCATAATCTTGGAATGAATCACGATGATGGG
AGAGATTGTTCCTGTGGAGCAAAGAGCTGCATCATGAATTCAGGAGCATCGGGTTCCAGA
AACTTTAGCAGTTGCAGTGCAGAGGACTTTGAGAAGTTAACTTTAAATAAAGGAGGAAAC
TGCCTTCTTAATATTCCAAAGCCTGATGAAGCCTATAGTGCTCCCTCCTGTGGTAATAAG
TTGGTGGACGCTGGGGAAGAGTGTGACTGTGGTACTCCAAAGGAATGTGAATTGGACCCT
TGCTGCGAAGGAAGTACCTGTAAGCTTAAATCATTTGCTGAGTGTGCATATGGTGACTGT
TGTAAAGACTGTCGGTTCCTTCCAGGAGGTACTTTATGCCGAGGAAAAACCAGTGAGTGT
GATGTTCCAGAGTACTGCAATGGTTCTTCTCAGTTCTGTCAGCCAGATGTTTTTATTCAG
AATGGATATCCTTGCCAGAATAACAAAGCCTATTGCTACAACGGCATGTGCCAGTATTAT
GATGCTCAATGTCAAGTCATCTTTGGCTCAAAAGCCAAGGCTGCCCCCAAAGATTGTTTC
ATTGAAGTGAATTCTAAAGGTGACAGATTTGGCAATTGTGGTTTCTCTGGCAATGAATAC
AAGAAGTGTGCCACTGGGAATGCTTTGTGTGGAAAGCTTCAGTGTGAGAATGTACAAGAG
ATACCTGTATTTGGAATTGTGCCTGCTATTATTCAAACGCCTAGTCGAGGCACCAAATGT
TGGGGTGTGGATTTCCAGCTAGGATCAGATGTTCCAGATCCTGGGATGGTTAACGAAGGC
ACAAAATGTGGTGCTGGAAAGATCTGTAGAAACTTCCAGTGTGTAGATGCTTCTGTTCTG
AATTATGACTGTGATGTTCAGAAAAAGTGTCATGGACATGGGGTATGTAATAGCAATAAG
AATTGTCACTGTGAAAATGGCTGGGCTCCCCCAAATTGTGAGACTAAAGGATACGGAGGA
AGTGTGGACAGTGGACCTACATACAATGAAATGAATACTGCATTGAGGGACGGACTTCTG
GTCTTCTTCTTCCTAATTGTTCCCCTTATTGTCTGTGCTATTTTTATCTTCATCAAGAGG
GATCAACTGTGGAGAAGCTACTTCAGAAAGAAGAGATCACAAACATATGAGTCAGATGGC
AAAAATCAAGCAAACCCTTCTAGACAGCCGGGGAGTGTTCCTCGACATGTTTCTCCAGTG
ACACCTCCCAGAGAAGTTCCTATATATGCAAACAGATTTGCAGTACCAACCTATGCAGCC
AAGCAACCTCAGCAGTTCCCATCAAGGCCACCTCCACCACAACCGAAAGTATCATCTCAG
GGAAACTTAATTCCTGCCCGTCCTGCTCCTGCACCTCCTTTATATAGTTCCCTCACTTGA
Protein Properties
Number of Residues 819
Molecular Weight 90555.3
Theoretical pI 7.55
Pfam Domain Function
Signals
  • 1-28
Transmembrane Regions
  • 698-718
Protein Sequence
>Disintegrin and metalloproteinase domain-containing protein 9
MGSGARFPSGTLRVRWLLLLGLVGPVLGAARPGFQQTSHLSSYEIITPWRLTRERREAPR
PYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYV
EGVHNSSIALSDCFGLRGLLHLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNK
DIEKETAKDEEEEPPSMTQLLRRRRAVLPQTRYVELFIVVDKERYDMMGRNQTAVREEMI
LLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDS
AQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDG
RDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNK
LVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKDCRFLPGGTLCRGKTSEC
DVPEYCNGSSQFCQPDVFIQNGYPCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCF
IEVNSKGDRFGNCGFSGNEYKKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKC
WGVDFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDASVLNYDCDVQKKCHGHGVCNSNK
NCHCENGWAPPNCETKGYGGSVDSGPTYNEMNTALRDGLLVFFFLIVPLIVCAIFIFIKR
DQLWRSYFRKKRSQTYESDGKNQANPSRQPGSVPRHVSPVTPPREVPIYANRFAVPTYAA
KQPQQFPSRPPPPQPKVSSQGNLIPARPAPAPPLYSSLT
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q13443
UniProtKB/Swiss-Prot Entry Name ADAM9_HUMAN
PDB IDs Not Available
GenBank Gene ID U41766
GeneCard ID ADAM9
GenAtlas ID ADAM9
HGNC ID HGNC:216
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  5. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  6. Nomura N, Miyajima N, Sazuka T, Tanaka A, Kawarabayasi Y, Sato S, Nagase T, Seki N, Ishikawa K, Tabata S: Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1. DNA Res. 1994;1(1):27-35. [PubMed:7584026 ]
  7. Weskamp G, Kratzschmar J, Reid MS, Blobel CP: MDC9, a widely expressed cellular disintegrin containing cytoplasmic SH3 ligand domains. J Cell Biol. 1996 Feb;132(4):717-26. [PubMed:8647900 ]
  8. McKie N, Dallas DJ, Edwards T, Apperley JF, Russell RG, Croucher PI: Cloning of a novel membrane-linked metalloproteinase from human myeloma cells. Biochem J. 1996 Sep 1;318 ( Pt 2):459-62. [PubMed:8809033 ]
  9. Hotoda N, Koike H, Sasagawa N, Ishiura S: A secreted form of human ADAM9 has an alpha-secretase activity for APP. Biochem Biophys Res Commun. 2002 May 3;293(2):800-5. [PubMed:12054541 ]
  10. McKie N, Edwards T, Dallas DJ, Houghton A, Stringer B, Graham R, Russell G, Croucher PI: Expression of members of a novel membrane linked metalloproteinase family (ADAM) in human articular chondrocytes. Biochem Biophys Res Commun. 1997 Jan 13;230(2):335-9. [PubMed:9016778 ]
  11. Parry DA, Toomes C, Bida L, Danciger M, Towns KV, McKibbin M, Jacobson SG, Logan CV, Ali M, Bond J, Chance R, Swendeman S, Daniele LL, Springell K, Adams M, Johnson CA, Booth AP, Jafri H, Rashid Y, Banin E, Strom TM, Farber DB, Sharon D, Blobel CP, Pugh EN Jr, Pierce EA, Inglehearn CF: Loss of the metalloprotease ADAM9 leads to cone-rod dystrophy in humans and retinal degeneration in mice. Am J Hum Genet. 2009 May;84(5):683-91. doi: 10.1016/j.ajhg.2009.04.005. Epub 2009 Apr 30. [PubMed:19409519 ]