You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09220
Secondary Accession Numbers
  • 15003
Name Neurolysin, mitochondrial
Synonyms
  1. Angiotensin-binding protein
  2. MEP
  3. Microsomal endopeptidase
  4. Mitochondrial oligopeptidase M
  5. Neurotensin endopeptidase
Gene Name NLN
Protein Type Enzyme
Biological Properties
General Function Involved in metalloendopeptidase activity
Specific Function Hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A
Pathways Not Available
Reactions Not Available
GO Classification
Function
endopeptidase activity
catalytic activity
hydrolase activity
metalloendopeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Cytoplasm
  2. Mitochondrion intermembrane space
Gene Properties
Chromosome Location Chromosome:5
Locus 5q12.3
SNPs NLN
Gene Sequence
>2115 bp
ATGATCGCCCGGTGCCTTTTGGCTGTGCGAAGCCTCCGCAGAGTTGGTGGTTCCAGGATT
TTACTCAGAATGACGTTAGGAAGAGAAGTGATGTCTCCTCTTCAGGCAATGTCTTCCTAT
ACTGTGGCTGGCAGAAATGTTTTAAGATGGGATCTTTCACCAGAGCAAATTAAAACAAGA
ACTGAGGAGCTCATTGTGCAGACCAAACAGGTGTACGATGCTGTTGGAATGCTCGGTATT
GAGGAAGTAACTTACGAGAACTGTCTGCAGGCACTGGCAGATGTAGAAGTAAAGTATATA
GTGGAAAGGACCATGCTAGACTTTCCCCAGCATGTATCCTCTGACAAAGAAGTACGAGCA
GCAAGTACAGAAGCAGACAAAAGACTTTCTCGTTTTGATATTGAGATGAGCATGAGAGGA
GATATATTTGAGAGAATTGTTCATTTACAGGAAACCTGTGATCTGGGGAAGATAAAACCT
GAGGCCAGACGATACTTGGAAAAGTCAATTAAAATGGGGAAAAGAAATGGGCTCCATCTT
CCTGAACAAGTACAGAATGAAATCAAATCAATGAAGAAAAGAATGAGTGAGCTATGTATT
GATTTTAACAAAAACCTCAATGAGGATGATACCTTCCTTGTATTTTCCAAGGCTGAACTT
GGTGCTCTTCCTGATGATTTCATTGACAGTTTAGAAAAGACAGATGATGACAAGTATAAA
ATTACCTTAAAATATCCACACTATTTCCCTGTCATGAAGAAATGTTGTATCCCTGAAACC
AGAAGAAGGATGGAAATGGCTTTTAATACAAGGTGCAAAGAGGAAAACACCATAATTTTG
CAGCAGCTACTCCCACTGCGAACCAAGGTGGCCAAACTACTCGGTTATAGCACACATGCT
GACTTCGTCCTTGAAATGAACACTGCAAAGAGCACAAGCCGCGTAACAGCCTTTCTAGAT
GATTTAAGCCAGAAGTTAAAACCCTTGGGTGAAGCAGAACGAGAGTTTATTTTGAATTTG
AAGAAAAAGGAATGCAAAGACAGGGGTTTTGAATATGATGGGAAAATCAATGCCTGGGAT
CTATATTACTACATGACTCAGACAGAGGAACTCAAGTATTCCATAGACCAAGAGTTCCTC
AAGGAATACTTCCCAATTGAGGTGGTCACTGAAGGCTTGCTGAACACCTACCAGGAGTTG
TTGGGACTTTCATTTGAACAAATGACAGATGCTCATGTTTGGAACAAGAGTGTTACACTT
TATACTGTGAAGGATAAAGCTACAGGAGAAGTATTGGGACAGTTCTATTTGGACCTCTAT
CCAAGGGAAGGAAAATACAATCATGCGGCCTGCTTCGGTCTCCAGCCTGGCTGCCTTCTG
CCTGATGGAAGCCGGATGATGGCAGTGGCTGCCCTCGTGGTGAACTTCTCACAGCCAGTG
GCAGGTCGTCCCTCTCTCCTGAGACACGACGAGGTGAGGACTTACTTTCATGAGTTTGGT
CACGTGATGCATCAGATTTGTGCACAGACTGATTTTGCACGATTTAGCGGAACAAATGTG
GAAACTGACTTTGTAGAGGTGCCATCGCAAATGCTTGAAAATTGGGTGTGGGACGTCGAT
TCCCTCCGAAGATTGTCAAAACATTATAAAGATGGAAGCCCTATTGCAGACGATCTGCTT
GAAAAACTTGTTGCTTCTAGGCTGGTCAACACAGGTCTTCTGACCCTGCGCCAGATTGTT
TTGAGCAAAGTTGATCAGTCTCTTCATACCAACACATCGCTGGATGCTGCAAGTGAATAT
GCCAAATACTGCTCAGAAATATTAGGAGTTGCAGCTACTCCAGGCACAAATATGCCAGCT
ACCTTTGGACATTTGGCAGGGGGATACGATGGCCAATATTATGGATATCTTTGGAGTGAA
GTATTTTCCATGGATATGTTTTACAGCTGTTTTAAAAAAGAAGGGATAATGAATCCAGAG
GTTGGAATGAAATACAGAAACCTAATCCTGAAACCTGGGGGATCTCTGGACGGCATGGAC
ATGCTCCACAATTTCTTGAAACGTGAGCCAAACCAAAAAGCGTTCCTAATGAGTAGAGGC
CTGCATGCTCCGTGA
Protein Properties
Number of Residues 704
Molecular Weight 80651.1
Theoretical pI 6.62
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Neurolysin, mitochondrial
MIARCLLAVRSLRRVGGSRILLRMTLGREVMSPLQAMSSYTVAGRNVLRWDLSPEQIKTR
TEELIVQTKQVYDAVGMLGIEEVTYENCLQALADVEVKYIVERTMLDFPQHVSSDKEVRA
ASTEADKRLSRFDIEMSMRGDIFERIVHLQETCDLGKIKPEARRYLEKSIKMGKRNGLHL
PEQVQNEIKSMKKRMSELCIDFNKNLNEDDTFLVFSKAELGALPDDFIDSLEKTDDDKYK
ITLKYPHYFPVMKKCCIPETRRRMEMAFNTRCKEENTIILQQLLPLRTKVAKLLGYSTHA
DFVLEMNTAKSTSRVTAFLDDLSQKLKPLGEAEREFILNLKKKECKDRGFEYDGKINAWD
LYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNTYQELLGLSFEQMTDAHVWNKSVTL
YTVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQPGCLLPDGSRMMAVAALVVNFSQPV
AGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDVD
SLRRLSKHYKDGSPIADDLLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTNTSLDAASEY
AKYCSEILGVAATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSCFKKEGIMNPE
VGMKYRNLILKPGGSLDGMDMLHNFLKREPNQKAFLMSRGLHAP
GenBank ID Protein 20521802
UniProtKB/Swiss-Prot ID Q9BYT8
UniProtKB/Swiss-Prot Entry Name NEUL_HUMAN
PDB IDs
GenBank Gene ID AB033052
GeneCard ID NLN
GenAtlas ID NLN
HGNC ID HGNC:16058
References
General References
  1. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  4. Nagase T, Ishikawa K, Kikuno R, Hirosawa M, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Oct 29;6(5):337-45. [PubMed:10574462 ]