You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09241
Secondary Accession Numbers
  • 15060
Name Thymidine kinase
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Involved in ATP binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
phosphotransferase activity, alcohol group as acceptor
Process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs Not Available
Gene Sequence
>924 bp
ATGCGACCGGGTCTCTTTAAGGGCCAGGCGCCGGGATCCAGGCGGCGCCCAACGGCTGGA
CTAGCAGTCGTCCGCGCCGACTCGCACAGGAAGGAACCCCGGGCCTCTGGATCCGCTCGC
CCGGCTATGCTGCTGTGGCCGCTGCGGGGCTGGGCCGCCCGGGCGCTGCGCTGCTTTGGG
CCGGGAAGTCGCGGGAGCCCGGCCTCAGGCCCCGGGCCGCGGAGGGTGCAGCGCCGGGCC
TGGCCTCCCGATAAAGAACAGGAAAAAGAGAAAAAATCAGTGATCTGTGTCGAGGGCAAT
ATTGCAAGTGGGAAGACGACATGCCTGGAATTCTTCTCCAACGCGACAGACGTCGAGGTG
TTAACGGAGCCTGTGTCCAAGTGGAGAAATGTCCGTGGCCACAATCCTCTGGGCCTGATG
TACCACGATGCCTCTCGCTGGGGTCTTACGCTACAGACTTATGTGCAGCTCACCATGCTG
GACAGGCATACTCGTCCTCAGGTGTCATCTGTACGGTTGATGGAGAGGTCGATTCACAGC
GCAAGATACATTTTTGTAGAAAACCTGTATAGAAGTGGGAAGATGCCAGAAGTGGACTAT
GTAGTTCTGTCGGAATGGTTTGACTGGATCTTGAGGAACATGGACGTGTCTGTTGATTTG
ATAGTTTACCTTCGGACCAATCCTGAGACTTGTTACCAGAGGTTAAAGAAGAGATGCAGG
GAAGAGGAGAAGGTCATTCCGCTGGAATACCTGGAAGCAATTCACCATCTCCATGAGGAG
TGGCTCATCAAAGGCAGCCTTTTCCCCATGGCAGCCCCTGTTCTGGTGATTGAGGCTGAC
CACCACATGGAGAGGATGTTACAACTCTTTGAACAAAATCGGGATCGAATATTAACTCCA
GAGAATCGGAAGCATTGCCCATAG
Protein Properties
Number of Residues 307
Molecular Weight 35439.6
Theoretical pI 10.07
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Thymidine kinase
MRPGLFKGQAPGSRRRPTAGLAVVRADSHRKEPRASGSARPAMLLWPLRGWAARALRCFG
PGSRGSPASGPGPRRVQRRAWPPDKEQEKEKKSVICVEGNIASGKTTCLEFFSNATDVEV
LTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSIHS
ARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCR
EEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLQLFEQNRDRILTP
ENRKHCP
GenBank ID Protein 25167087
UniProtKB/Swiss-Prot ID Q8IZR3
UniProtKB/Swiss-Prot Entry Name Q8IZR3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF521891
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:11831
References
General References Not Available