Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09261
Secondary Accession Numbers
  • 15089
Name Membrane-associated ring finger (C3HC4) 6 (Membrane-associated ring finger (C3HC4) 6, isoform CRA_a)
Synonyms Not Available
Gene Name MARCH6
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
protein complex
ubiquitin ligase complex
Function
ion binding
cation binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
ligase activity
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
ubiquitin-protein ligase activity
Process
biopolymer metabolism
biopolymer modification
protein modification
ubiquitin cycle
protein ubiquitination
physiological process
metabolism
macromolecule metabolism
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs A5PKZ4
Gene Sequence
>2733 bp
ATGGACACCGCGGAGGAAGACATATGTAGAGTGTGTCGGTCAGAAGGAACACCTGAGAAA
CCGCTTTATCATCCTTGTGTATGTACTGGCAGTATTAAGTTTATCCATCAAGAATGCTTA
GTTCAATGGCTGAAACACAGTCGAAAAGAATACTGTGAATTATGCAAGCACAGATTTGCT
TTTACACCAATTTATTCTCCAGATATGCCTTCACGGCTTCCAATTCAAGACATATTTGCT
GGACTGGTTACAAGTATTGGCACTGCAATACGATATTGGTTTCATTATACACTTGTGGCC
TTTGCATGGTTGGGAGTTGTTCCTCTTACAGCATGCCGCATCTACAAGTGCTTGTTTACT
GGCTCCGTGAGCTCACTACTGACGCTGCCATTAGATATGCTGTCAACGGAAAATTTGTTG
GCAGATTGTTTGCAGGGTTGTTTTGTGGTGACGTGCACACTGTGTGCATTCATCAGCCTG
GTGTGGTTGAGAGAGCAGATAGTCCATGGGGGAGCACCAATTTGGTTGGAGCATGCTGCC
CCACCGTTCAATGCTGCGGGGCATCACCAAAATGAGGCTCCAGCAGGAGGAAATGGTGCA
GAAAATGTTGCTGCTGATCAGCCTGCTAACCCACCAGCTGAGAACGCAGTGGTGGGGGAA
AACCCTGATGCCCAGGATGACCAGGCAGAAGAGGAGGAGGAGGACAATGAGGAGGAAGAT
GACGCTGGTGTGGAGGATGCGGCAGATGCTAATAACGGAGCCCAGGATGACATGAATTGG
AATGCTTTAGAATGGGACCGAGCTGCTGAAGAGCTTACATGGGAAAGAATGCTAGGACTT
GATGGATCACTAGTTTTTCTGGAACATGTCTTCTGGGTGGTATCTTTAAATACACTGTTC
ATTCTTGTTTTTGCATTTTGCCCTTACCATATTGGTCATTTCTCCCTTGTTGGTTTGGGA
TTTGAAGAACACGTCCAAGCATCTCATTTTGAAGGCCTAATCACAACCATAGTTGGGTAT
ATACTTTTAGCAATAACACTGATAATTTGTCATGGCTTGGCAACTCTTGTGAAATTTCAT
AGATCTCGTCGCTTACTGGGAGTCTGCTATATTGTTGTTAAGGTCTCTTTGTTAGTGGTG
GTAGAAATTGGAGTATTCCCTCTCATTTGTGGTTGGTGGCTGGATATCTGTTCCTTGGAA
ATGTTTGATGCTACTCTGAAAGATCGAGAACTGAGCTTTCAGTCGGCTCCAGGTACTACC
ATGTTTCTGCATTGGCTAGTGGGAATGGTATATGTCTTCTACTTTGCCTCCTTCATTCTA
CTACTGAGAGAGGTACTTCGACCTGGTGTCCTGTGGTTTCTAAGGAATTTGAATGATCCA
GATTTCAATCCAGTACAGGAAATGATCCATTTGCCAATATATAGGCATCTCCGAAGATTT
ATTTTGTCAGTGATTGTCTTTGGCTCCATTGTCCTCCTGATGCTTTGGCTTCCTATACGT
ATAATTAAGAGTGTGCTGCCTAATTTTCTTCCATACAATGTCATGCTCTACAGTGATGCT
CCAGTGAGTGAACTGTCCCTCGAGCTGCTTCTGCTTCAGGTTGTCTTGCCAGCATTACTC
GAACAGGGACACACGAGGCAGTGGCTGAAGGGGCTGGTGCGAGCGTGGACTGTGACCGCC
GGATACTTGCTGGATCTTCATTCTTATTTATTGGGAGACCAGGAAGAAAATGAAAACAGT
GCAAATCAACAAGTTAACAATAATCAGCATGCTCGAAATAACAACGCTATTCCTGTGGTG
GGAGAAGGCCTTCATGCAGCCCACCAAGCCATACTCCAGCAGGGAGGGCCTGTTGGCTTT
CAGCCTTACCGCCGACCTTTAAATTTTCCACTCAGGATATTTCTGTTGATTGTCTTCATG
TGTATAACATTACTGATTGCCAGCCTCATCTGCCTTACTTTACCAGTATTTGCTGGCCGT
TGGTTAATGTCGTTTTGGACGGGGACTGCCAAAATCCATGAGCTCTACACAGCTGCTTGT
GGTCTCTATGTTTGCTGGCTAACCATAAGGGCTGTGACGGTGATGGTGGCATGGATGCCT
CAGGGACGCAGAGTGATCTTCCAGAAGGTTAAAGAGTGGTCTCTCATGATCATGAAGACT
TTGATAGTTGCGGTGCTGTTGGCTGGAGTTGTCCCTCTCCTTCTGGGGCTCCTGTTTGAG
CTGGTCATTGTGGCTCCCCTGAGGGTTCCCTTGGATCAGACTCCTCTTTTTTATCCATGG
CAGGACTGGGCACTTGGAGTCCTGCATGCCAAAATCATTGCAGCTATAACATTGATGGGT
CCTCAGTGGTGGTTGAAAACTGTAATTGAACAGGTTTACGCAAATGGCATCCGGAACATT
GACCTTCACTATATTGTTCGTAAACTGGCAGCTCCCGTGATCTCTGTGCTGTTGCTTTCC
CTGTGTGTACCTTATGTCATAGCTTCTGGTGTTGTTCCTTTACTAGGTGTTACTGCGGAA
ATGCAAAACTTAGTCCATCGGCGGATTTATCCATTTTTACTGATGGTCGTGGTATTGATG
GCAATTTTGTCCTTCCAAGTCCGCCAGTTTAAGCGCCTTTATGAACATATTAAAAATGAC
AAGTACCTTGTGGGTCAACGACTCGTGAACTACGAACGGAAATCTGGCAAACAAGGCTCA
TCTCCACCGCCTCCACAGTCATCCCAAGAATAA
Protein Properties
Number of Residues 910
Molecular Weight 102547.0
Theoretical pI 6.25
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Membrane-associated ring finger (C3HC4) 6 (Membrane-associated ring finger (C3HC4) 6, isoform CRA_a)
MDTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFA
FTPIYSPDMPSRLPIQDIFAGLVTSIGTAIRYWFHYTLVAFAWLGVVPLTACRIYKCLFT
GSVSSLLTLPLDMLSTENLLADCLQGCFVVTCTLCAFISLVWLREQIVHGGAPIWLEHAA
PPFNAAGHHQNEAPAGGNGAENVAADQPANPPAENAVVGENPDAQDDQAEEEEEDNEEED
DAGVEDAADANNGAQDDMNWNALEWDRAAEELTWERMLGLDGSLVFLEHVFWVVSLNTLF
ILVFAFCPYHIGHFSLVGLGFEEHVQASHFEGLITTIVGYILLAITLIICHGLATLVKFH
RSRRLLGVCYIVVKVSLLVVVEIGVFPLICGWWLDICSLEMFDATLKDRELSFQSAPGTT
MFLHWLVGMVYVFYFASFILLLREVLRPGVLWFLRNLNDPDFNPVQEMIHLPIYRHLRRF
ILSVIVFGSIVLLMLWLPIRIIKSVLPNFLPYNVMLYSDAPVSELSLELLLLQVVLPALL
EQGHTRQWLKGLVRAWTVTAGYLLDLHSYLLGDQEENENSANQQVNNNQHARNNNAIPVV
GEGLHAAHQAILQQGGPVGFQPYRRPLNFPLRIFLLIVFMCITLLIASLICLTLPVFAGR
WLMSFWTGTAKIHELYTAACGLYVCWLTIRAVTVMVAWMPQGRRVIFQKVKEWSLMIMKT
LIVAVLLAGVVPLLLGLLFELVIVAPLRVPLDQTPLFYPWQDWALGVLHAKIIAAITLMG
PQWWLKTVIEQVYANGIRNIDLHYIVRKLAAPVISVLLLSLCVPYVIASGVVPLLGVTAE
MQNLVHRRIYPFLLMVVVLMAILSFQVRQFKRLYEHIKNDKYLVGQRLVNYERKSGKQGS
SPPPPQSSQE
GenBank ID Protein 148745657
UniProtKB/Swiss-Prot ID O60337
UniProtKB/Swiss-Prot Entry Name A5PKZ4_HUMAN
PDB IDs Not Available
GenBank Gene ID BC142679
GeneCard ID A5PKZ4
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA: Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11. [PubMed:12477932 ]