Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09262
Secondary Accession Numbers
  • 15090
Name TGIF-interacting ubiquitin ligase 1
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Involved in acid-amino acid ligase activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
binding
catalytic activity
ligase activity
protein binding
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs Not Available
Gene Sequence
>2769 bp
ATGGCCACTGCTTCACCAAGGTCTGATACTAGTAATAACCACAGTGGAAGGTTGCAGTTA
CAGGTAACTGTTTCTAGTGCCAAACTTAAAAGAAAAAAGAACTGGTTCGGAACAGCAATA
TATACAGAAGTAGTTGTAGATGGAGAAATTACGAAAACAGCAAAATCCAGTAGTTCTTCT
AATCCAAAATGGGATGAACAGCTAACTGTAAATGTTACGCCACAGACTACATTGGAATTT
CAAGTTTGGAGCCATCGCACTTTAAAAGCAGATGCTTTATTAGGAAAAGCAACGATAGAT
TTGAAACAAGCTCTGTTGATACACAATAGAAAATTGGAAAGAGTGAAAGAACAATTAAAA
CTTTCCTTGGAAAACAAGAATGGCATAGCACAAACTGGTGAATTGACAGTTGTGCTTGAT
GGATTGGTGATTGAGCAAGAAAATATAACAAACTGCAGCTCATCTCCAACCATAGAAATA
CAGGAAAATGGTGATGCCTTACATGAAAATGGAGAGCCTTCAGCAAGGACAACTGCCAGG
TTGGCTGTTGAAGGCACGAATGGAATAGATAATCATGTACCTACAAGCACTCTAGTCCAA
AACTCATGCTGCTCGTATGTAGTTAATGGAGACAACACACCTTCATCTCCGTCTCAGGTT
GCTGCCAGACCCAAAAATACACCAGCTCCAAAACCACTCGCATCTGAGCCTGCCGATGAC
ACTGTTAATGGAGAATCATCCTCATTTGCACCAACTGATAATGCGTCTGTCACGGGTACT
CCAGTAGTGTCTGAAGAAAATGCCTTGTCTCCAAATTGCACTAGTACTACTGTTGAAGAT
CCTCCAGTTCAAGAAATACTGACTTCCTCAGAAAACAATGAATGTATTCCTTCTACCAGT
GCAGAATTGGAATCTGAAGCTAGAAGTATATTAGAGCCTGACACCTCTAATTCTAGAAGT
AGTTCTGCTTTTGAAGCAGCCAAATCAAGACAGCCAGATGGGTGTATGGATCCTGTACGG
CAGCAGTCTGGGAATGCCAACACAGAAACCTTGCCATCAGGGTGGGAACAAAGAAAAGAT
CCTCATGGTAGAACCTATTATGTGGATCATAATACTCGAACTACCACATGGGAGAGACCA
CAACCTTTACCTCCAGGTTGGGAAAGAAGAGTTGATGATCGTAGAAGAGTTTATTATGTG
GATCATAACACCAGAACAACAACGTGGCAGCGGCCTACCATGGAATCTGTCCGAAATTTT
GAACAGTGGCAATCTCAGCGGAACCAATTGCAGGGAGCTATGCAACAGTTTAACCAACGA
TACCTCTATTCGGCTTCAATGTTAGCTGCAGAAAATGACCCTTATGGACCTTTGCCACCA
GGCTGGGAAAAAAGAGTGGATTCAACAGACAGGGTTTACTTTGTGAATCATAACACAAAA
ACAACCCAGTGGGAAGATCCAAGAACTCAAGGCTTACAGAATGAAGAACCCCTGCCAGAA
GGCTGGGAAATTAGATATACTCGTGAAGGTGTAAGGTACTTTGTTGATCATAACACAAGA
ACAACAACATTCAAAGATCCTCGCAATGGGAAGTCATCTGTAACTAAAGGTGGTCCACAA
ATTGCTTATGAACGCGGCTTTAGGTGGAAGCTTGCTCACTTCCGTTATTTGTGCCAGTCT
AATGCACTACCTAGTCATGTAAAGATCAATGTGTCCCGGCAGACATTGTTTGAAGATTCC
TTCCAACAGATTATGGCATTAAAACCCTATGACTTGAGGAGGCGCTTATATGTAATATTT
AGAGGAGAAGAAGGACTTGATTATGGTGGCCTAGCGAGAGAATGGTTTTTCTTGCTTTCA
CATGAAGTTTTGAACCCAATGTATTGCTTATTTGAGTATGCGGGCAAGAACAACTATTGT
CTGCAGATAAATCCAGCATCAACCATTAATCCAGACCATCTTTCATACTTCTGTTTCATT
GGTCGTTTTATTGCCATGGCACTATTTCATGGAAAGTTTATCGATACTGGTTTCTCTTTA
CCATTCTACAAGCGTATGTTAAGTAAAAAACTTACTATTAAGGATTTGGAATCTATTGAT
ACTGAATTTTATAACTCCCTTATCTGGATAAGAGATAACAACATTGAAGAATGTGGCTTA
GAAATGTACTTTTCTGTTGACATGGAGATTTTGGGAAAAGTTACTTCACATGACCTGAAG
TTGGGAGGTTCCAATATTCTGGTGACTGAGGAGAACAAAGATGAATATATTGGTTTAATG
ACAGAATGGCGTTTTTCTCGAGGAGTACAAGAACAGACCAAAGCTTTCCTTGATGGTTTT
AATGAAGTTGTTCCTCTTCAGTGGCTACAGTACTTCGATGAAAAAGAATTAGAGGTTATG
TTGTGTGGCATGCAGGAGGTTGACTTGGCAGATTGGCAGAGAAATACTGTTTATCGACAT
TATACAAGAAACAGCAAGCAAATCATTTGGTTTTGGCAGTTTGTGAAAGAGACAGACAAT
GAAGTAAGAATGCGACTATTGCAGTTCGTCACTGGAACCTGCCGTTTACCTCTAGGAGGA
TTTGCTGAGCTCATGGGAAGTAATGGGCCTCAAAAGTTTTGCATTGAAAAAGTTGGCAAA
GACACTTGGTTACCAAGAAGCCATACATGTTTTAATCGCTTGGATCTACCACCATATAAG
AGTTATGAACAACTAAAGGAAAAACTTCTTTTTGCAATAGAAGAGACAGAGGGATTTGGA
CAAGAATGA
Protein Properties
Number of Residues 922
Molecular Weight 105201.0
Theoretical pI 5.71
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>TGIF-interacting ubiquitin ligase 1
MATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEITKTAKSSSSS
NPKWDEQLTVNVTPQTTLEFQVWSHRTLKADALLGKATIDLKQALLIHNRKLERVKEQLK
LSLENKNGIAQTGELTVVLDGLVIEQENITNCSSSPTIEIQENGDALHENGEPSARTTAR
LAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADD
TVNGESSSFAPTDNASVTGTPVVSEENALSPNCTSTTVEDPPVQEILTSSENNECIPSTS
AELESEARSILEPDTSNSRSSSAFEAAKSRQPDGCMDPVRQQSGNANTETLPSGWEQRKD
PHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRRRVYYVDHNTRTTTWQRPTMESVRNF
EQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTK
TTQWEDPRTQGLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQ
IAYERGFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIF
RGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFI
GRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNNIEECGL
EMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGF
NEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDN
EVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYK
SYEQLKEKLLFAIEETEGFGQE
GenBank ID Protein 33590476
UniProtKB/Swiss-Prot ID Q9H0M0
UniProtKB/Swiss-Prot Entry Name Q5YLC1_HUMAN
PDB IDs
GenBank Gene ID AY345857
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17004
References
General References
  1. Seo SR, Lallemand F, Ferrand N, Pessah M, L'Hoste S, Camonis J, Atfi A: The novel E3 ubiquitin ligase Tiul1 associates with TGIF to target Smad2 for degradation. EMBO J. 2004 Oct 1;23(19):3780-92. Epub 2004 Sep 9. [PubMed:15359284 ]