You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09270
Secondary Accession Numbers
  • 15098
Name E3 ubiquitin-protein ligase ZNRF2
Synonyms
  1. Protein Ells2
  2. RING finger protein 202
  3. Zinc/RING finger protein 2
Gene Name ZNRF2
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function May play a role in the establisment and maintenance of neuronal transmission and plasticity via its ubiquitin ligase activity. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
protein binding
Cellular Location
  1. Peripheral membrane protein
  2. Peripheral membrane protein
  3. Peripheral membrane protein
  4. Endosome membrane
  5. Lysosome membrane
  6. Cell junction
  7. synapse
  8. presynaptic cell membrane
Gene Properties
Chromosome Location Chromosome:7
Locus 7p14.3
SNPs ZNRF2
Gene Sequence
>729 bp
ATGGGCGCCAAACAGAGCGGCCCGGCCGCCGCTAACGGCCGCACGCGCGCGTACTCGGGC
TCGGATCTACCTTCCAGTAGCAGCGGAGGCGCCAATGGGACCGCGGGCGGCGGCGGGGGC
GCTCGGGCCGCCGCCGCGGGGAGGTTCCCGGCTCAGGTGCCCAGCGCGCACCAGCCCAGC
GCCTCCGGCGGCGCCGCGGCGGCCGCGGCGGCCCCGGCAGCCCCGGCGGCCCCGCGCAGC
CGCTCCCTCGGCGGGGCCGTGGGGAGCGTGGCGTCGGGGGCCCGCGCGGCGCAGTCCCCC
TTCAGCATCCCGAACAGCAGCAGCGGCCCGTACGGCTCGCAGGACTCGGTGCACAGCAGC
CCTGAGGACGGCGGCGGCGGCCGGGACCGGCCGGTGGGCGGGAGCCCCGGCGGGCCGCGC
CTGGTGATCGGCTCCTTACCAGCTCACCTCTCGCCGCACATGTTTGGAGGATTTAAGTGC
CCTGTATGCTCAAAATTTGTATCCTCAGATGAAATGGATTTGCATCTTGTAATGTGTTTA
ACAAAGCCACGAATAACCTATAATGAGGATGTACTGAGTAAAGATGCTGGGGAATGTGCA
ATATGCCTTGAAGAATTGCAGCAGGGAGATACTATAGCACGACTGCCTTGTCTATGCATA
TATCATAAAGGCTGCATAGATGAATGGTTTGAAGTAAATAGATCTTGCCCTGAGCACCCT
TCAGATTAA
Protein Properties
Number of Residues 242
Molecular Weight 24114.5
Theoretical pI 7.11
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>E3 ubiquitin-protein ligase ZNRF2
MGAKQSGPAAANGRTRAYSGSDLPSSSSGGANGTAGGGGGARAAAAGRFPAQVPSAHQPS
ASGGAAAAAAAPAAPAAPRSRSLGGAVGSVASGARAAQSPFSIPNSSSGPYGSQDSVHSS
PEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCL
TKPRITYNEDVLSKDAGECAICLEELQQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHP
SD
GenBank ID Protein 33324891
UniProtKB/Swiss-Prot ID Q8NHG8
UniProtKB/Swiss-Prot Entry Name ZNRF2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF513707
GeneCard ID ZNRF2
GenAtlas ID ZNRF2
HGNC ID HGNC:22316
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  6. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  7. Plans V, Scheper J, Soler M, Loukili N, Okano Y, Thomson TM: The RING finger protein RNF8 recruits UBC13 for lysine 63-based self polyubiquitylation. J Cell Biochem. 2006 Feb 15;97(3):572-82. [PubMed:16215985 ]
  8. Araki T, Milbrandt J: ZNRF proteins constitute a family of presynaptic E3 ubiquitin ligases. J Neurosci. 2003 Oct 15;23(28):9385-94. [PubMed:14561866 ]