Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09276
Secondary Accession Numbers
  • 15104
Name E3 ubiquitin-protein ligase AMFR
Synonyms
  1. AMF receptor, isoform 2
  2. Autocrine motility factor receptor, isoform 2
  3. RING finger protein 45
  4. gp78
Gene Name AMFR
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function E3 ubiquitin-protein ligase which can target both itself and other proteins including CD3D and APOB for proteasomal degradation. Mediates polyubiquitination of CYP3A4. Specific receptor for the autocrine motility factor. Mediates tumor invasion and metastasis. Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulun that are retrotranslocated in the cytosol. Promotes ubiquitination of misfolded proteins such as mutant CFTR; proposed to mediate sequential ubiquitination by recognizing already ubiquitin-conjugated substrates and to cooperate with E3 ubiquitin-protein ligase RNF5
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
protein binding
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 16q21
SNPs AMFR
Gene Sequence
>1932 bp
ATGCCGCTGCTCTTCCTCGAGCGCTTCCCCTGGCCCAGCCTCCGCACCTACACGGGCCTC
AGCGGCCTGGCCCTGCTGGGCACCATCATCAGCGCCTACCGCGCGCTCAGCCAGCCCGAG
GCCGGCCCCGGCGAGCCGGACCAGCTAACGGCCTCGCTGCAGCCTGAGCCGCCGGCGCCC
GCCCGGCCGAGCGCCGGGGGACCCCGGGCCCGCGATGTGGCCCAGTACCTGCTCTCAGAC
AGCCTCTTCGTGTGGGTTCTAGTAAATACCGCTTGCTGTGTTTTGATGTTGGTGGCTAAG
CTCATCCAGTGTATTGTGTTTGGCCCTCTTCGAGTGAGTGAGAGACAGCATCTCAAAGAC
AAATTTTGGAATTTTATTTTCTACAAGTTCATTTTCATCTTTGGTGTGCTGAATGTCCAG
ACAGTGGAAGAGGTGGTCATGTGGTGCCTCTGGTTTGCCGGACTTGTCTTTCTGCACCTG
ATGGTTCAGCTCTGCAAGGATCGATTTGAATATCTTTCCTTCTCGCCCACCACGCCGATG
AGCAGCCACGGTCGAGTCCTGTCCCTGTTGGTTGCCATGCTGCTTTCCTGCTGTGGACTG
GCGGCCGTCTGCTCCATCACCGGCTACACCCACGGAATGCACACCTTGGCTTTCATGGCT
GCAGAGTCTCTTCTTGTGACAGTGAGGACTGCTCATGTGATTTTACGATACGTAATTCAC
CTCTGGGACCTCAACCACGAAGGGACGTGGGAAGGAAAGGGGACGTATGTCTATTACACA
GACTTTGTCATGGAGCTCACTCTCCTGTCCCTGGACCTCATGCACCATATTCACATGTTG
TTATTTGGCAACATCTGGTTATCCATGGCCAGCCTGGTCATCTTTATGCAGCTGCGTTAC
CTGTTTCATGAGGTGCAACGTCGAATTCGTCGGCACAAGAACTATCTACGTGTGGTTGGA
AACATGGAGGCCAGGTTTGCAGTTGCAACTCCAGAGGAGCTGGCTGTCAACAATGACGAC
TGTGCCATCTGTTGGGACTCCATGCAGGCTGCGCGGAAACTGCCCTGTGGACATCTTTTC
CACAACTCCTGTCTTCGTTCCTGGCTAGAACAAGACACCTCCTGTCCAACATGCAGAATG
TCTCTTAATATTGCCGACAATAATCGTGTCAGGGAAGAACATCAAGGAGAGAACTTGGAT
GAGAATTTGGTTCCTGTAGCAGCAGCCGAAGGGAGACCTCGCTTAAACCAACACAATCAC
TTCTTCCATTTCGATGGGTCTCGGATTGCGAGCTGGCTGCCGAGTTTTTCGGTTGAAGTG
ATGCACACCACCAACATTCTTGGCATTACGCAGGCCAGCAACTCCCAGCTCAATGCAATG
GCTCATCAGATTCAAGAGATGTTTCCCCAGGTTCCATACCATCTGGTACTGCAGGACCTC
CAGCTGACACGCTCAGTTGAAATAACAACAGACAATATTTTAGAAGGACGGATTCAAGTA
CCTTTTCCTACACAGCGGTCAGATAGCATCAGACCTGCATTGAACAGTCCTGTGGAAAGG
CCAAGCAGTGACCAGGAAGAGGGAGAAACTTCTGCTCAGACCGAGCGTGTGCCACTGGAC
CTCAGTCCTCGCCTGGAGGAGACGCTGGACTTCGGCGAGGTGGAAGTGGAGCCCAGTGAG
GTGGAAGACTTCGAGGCTCGTGGGAGCCGCTTCTCCAAGTCTGCTGATGAGAGACAGCGC
ATGCTGGTGCAGCGTAAGGACGAACTCCTCCAGCAAGCTCGCAAACGTTTCTTGAACAAA
AGTTCTGAAGATGATGCGGCCTCAGAGAGCTTCCTCCCCTTGGAAGGTGCGTCCTCTGAC
CCCGTGACCCTGCGTCGAAGGATGCTGGCTGCCGCCGCGGAACGGAGGCTTCAGAAGCAG
CAGACCTCCTAG
Protein Properties
Number of Residues 643
Molecular Weight 72995.1
Theoretical pI 6.36
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 82-102
  • 122-142
  • 145-165
  • 186-206
  • 215-235
  • 276-296
  • 429-449
Protein Sequence
>E3 ubiquitin-protein ligase AMFR
MPLLFLERFPWPSLRTYTGLSGLALLGTIISAYRALSQPEAGPGEPDQLTASLQPEPPAP
ARPSAGGPRARDVAQYLLSDSLFVWVLVNTACCVLMLVAKLIQCIVFGPLRVSERQHLKD
KFWNFIFYKFIFIFGVLNVQTVEEVVMWCLWFAGLVFLHLMVQLCKDRFEYLSFSPTTPM
SSHGRVLSLLVAMLLSCCGLAAVCSITGYTHGMHTLAFMAAESLLVTVRTAHVILRYVIH
LWDLNHEGTWEGKGTYVYYTDFVMELTLLSLDLMHHIHMLLFGNIWLSMASLVIFMQLRY
LFHEVQRRIRRHKNYLRVVGNMEARFAVATPEELAVNNDDCAICWDSMQAARKLPCGHLF
HNSCLRSWLEQDTSCPTCRMSLNIADNNRVREEHQGENLDENLVPVAAAEGRPRLNQHNH
FFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDL
QLTRSVEITTDNILEGRIQVPFPTQRSDSIRPALNSPVERPSSDQEEGETSAQTERVPLD
LSPRLEETLDFGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK
SSEDDAASESFLPSEGASSDPVTLRRRMLAAAAERRLQKQQTS
GenBank ID Protein 5931955
UniProtKB/Swiss-Prot ID Q9UKV5
UniProtKB/Swiss-Prot Entry Name AMFR2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF124145
GeneCard ID AMFR
GenAtlas ID AMFR
HGNC ID HGNC:463
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  5. Pabarcus MK, Hoe N, Sadeghi S, Patterson C, Wiertz E, Correia MA: CYP3A4 ubiquitination by gp78 (the tumor autocrine motility factor receptor, AMFR) and CHIP E3 ligases. Arch Biochem Biophys. 2009 Mar 1;483(1):66-74. doi: 10.1016/j.abb.2008.12.001. Epub 2008 Dec 10. [PubMed:19103148 ]
  6. Shimizu K, Tani M, Watanabe H, Nagamachi Y, Niinaka Y, Shiroishi T, Ohwada S, Raz A, Yokota J: The autocrine motility factor receptor gene encodes a novel type of seven transmembrane protein. FEBS Lett. 1999 Aug 6;456(2):295-300. [PubMed:10456327 ]
  7. Fang S, Ferrone M, Yang C, Jensen JP, Tiwari S, Weissman AM: The tumor autocrine motility factor receptor, gp78, is a ubiquitin protein ligase implicated in degradation from the endoplasmic reticulum. Proc Natl Acad Sci U S A. 2001 Dec 4;98(25):14422-7. Epub 2001 Nov 27. [PubMed:11724934 ]
  8. Liang JS, Kim T, Fang S, Yamaguchi J, Weissman AM, Fisher EA, Ginsberg HN: Overexpression of the tumor autocrine motility factor receptor Gp78, a ubiquitin protein ligase, results in increased ubiquitinylation and decreased secretion of apolipoprotein B100 in HepG2 cells. J Biol Chem. 2003 Jun 27;278(26):23984-8. Epub 2003 Apr 1. [PubMed:12670940 ]
  9. Ye Y, Shibata Y, Kikkert M, van Voorden S, Wiertz E, Rapoport TA: Recruitment of the p97 ATPase and ubiquitin ligases to the site of retrotranslocation at the endoplasmic reticulum membrane. Proc Natl Acad Sci U S A. 2005 Oct 4;102(40):14132-8. Epub 2005 Sep 26. [PubMed:16186510 ]