You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09279
Secondary Accession Numbers
  • 15107
Name Myosin regulatory light chain interacting protein (Myosin regulatory light chain interacting protein, isoform CRA_a)
Synonyms Not Available
Gene Name MYLIP
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
non-membrane-bound organelle
intracellular non-membrane-bound organelle
membrane
cytoplasm
cytoskeleton
protein complex
organelle
intracellular
ubiquitin ligase complex
cell
Function
ion binding
cation binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
ligase activity
protein binding
cytoskeletal protein binding
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
ubiquitin-protein ligase activity
Process
biopolymer metabolism
biopolymer modification
protein modification
ubiquitin cycle
protein ubiquitination
physiological process
metabolism
macromolecule metabolism
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs Q5TIA4
Gene Sequence
>1338 bp
ATGCTGTGTTATGTGACGAGGCCGGACGCGGTGCTGATGGAGGTGGAGGTGGAGGCGAAA
GCCAACGGCGAGGACTGCCTCAACCAGGTGTGCAGGCGACTGGGAATCATAGAAGTTGAC
TATTTTGGACTGCAGTTTACGGGTAGCAAAGGTGAAAGTTTATGGCTAAACCTGAGAAAC
CGGATCTCCCAGCAGATGGATGGGCTAGCCCCTTACAGGCTTAAACTTAGAGTCAAGTTC
TTCGTGGAGCCTCATCTCATCTTACAGGAGCAGACTAGGCATATCTTTTTCTTGCACATC
AAGGAGGCCCTCTTGGCAGGCCACCTCTTGTGTTCCCCAGAGCAGGCAGTGGAACTCAGT
GCCCTCCTGGCCCAGACCAAGTTTGGAGACTACAACCAGAACACTGCCAAGTATAACTAT
GAGGAGCTCTGTGCCAAGGAGCTCTCCTCTGCCACCTTGAACAGCATTGTTGCAAAACAT
AAGGAGTTGGAGGGGACCAGCCAGGCTTCAGCTGAATACCAAGTTTTGCAGATTGTGTCG
GCAATGGAAAACTATGGCATAGAATGGCATTCTGTGCGGGATAGCGAAGGGCAGAAACTG
CTCATTGGGGTTGGACCTGAAGGAATCTCAATTTGTAAAGATGACTTTAGCCCAATTAAT
AGGATAGCTTATCCTGTGGTGCAGATGGCCACCCAGTCAGGAAAGAATGTATATTTGACG
GTCACCAAGGAATCTGGGAACAGCATCGTGCTCTTGTTTAAAATGATCAGCACCAGGGCG
GCCAGCGGGCTCTACCGAGCGATAACAGAGACGCACGCATTCTACAGGTGTGACACAGTG
ACCAGCGCCGTGATGATGCAGTATAGCCGTGACTTGAAGGGCCACTTGGCATCTCTGTTT
CTGAATGAAAACATTAACCTTGGCAAGAAATATGTCTTTGATATTAAAAGAACATCAAAG
GAGGTGTATGACCATGCCAGGAGGGCTCTGTACAATGCTGGCGTTGTGGACCTCGTTTCA
AGAAACAACCAGAGCCCTTCACACTCGCCTCTGAAGTCCTCAGAAAGCAGCATGAACTGC
AGCAGCTGCGAGGGCCTCAGCTGCCAGCAGACCCGGGTGCTGCAGGAGAAGCTACGCAAG
CTGAAGGAAGCCATGCTGTGCATGGTGTGCTGCGAGGAGGAGATCAACTCCACCTTCTGT
CCCTGTGGCCACACTGTGTGCTGTGAGAGCTGCGCCGCCCAGCTACAGTCATGTCCCGTC
TGCAGGTCGCGTGTGGAGCATGTCCAGCACGTCTATCTGCCAACGCACACCAGTCTTCTC
AATCTGACTGTAATCTAA
Protein Properties
Number of Residues 445
Molecular Weight 49911.0
Theoretical pI 7.25
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Myosin regulatory light chain interacting protein (Myosin regulatory light chain interacting protein, isoform CRA_a)
MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRN
RISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKEALLAGHLLCSPEQAVELS
ALLAQTKFGDYNQNTAKYNYEELCAKELSSATLNSIVAKHKELEGTSQASAEYQVLQIVS
AMENYGIEWHSVRDSEGQKLLIGVGPEGISICKDDFSPINRIAYPVVQMATQSGKNVYLT
VTKESGNSIVLLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLF
LNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRNNQSPSHSPLKSSESSMNC
SSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPV
CRSRVEHVQHVYLPTHTSLLNLTVI
GenBank ID Protein 56202482
UniProtKB/Swiss-Prot ID Q8WY64
UniProtKB/Swiss-Prot Entry Name Q5TIA4_HUMAN
PDB IDs Not Available
GenBank Gene ID AL021407
GeneCard ID Q5TIA4
GenAtlas ID MYLIP
HGNC ID HGNC:21155
References
General References Not Available