Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09287
Secondary Accession Numbers
  • 15116
Name E3 ubiquitin-protein ligase TRIM33
Synonyms
  1. Ectodermin homolog
  2. Protein Rfg7
  3. RET-fused gene 7 protein
  4. TIF1-gamma
  5. Transcription intermediary factor 1-gamma
  6. Tripartite motif-containing protein 33
Gene Name TRIM33
Protein Type Enzyme
Biological Properties
General Function Involved in zinc ion binding
Specific Function Acts as an E3 ubiquitin-protein ligase. Promotes SMAD4 ubiquitination, nuclear exclusion and degradation via the ubiquitin proteasome pathway. According to PubMed:16751102, does not promote a decrease in the level of endogenous SMAD4. May act as a transcriptional repressor. Inhibits the transcriptional response to TGF-beta/BMP signaling cascade. Plays a role in the control of cell proliferation. Its association with SMAD2 and SMAD3 stimulates erythroid differentiation of hematopoietic stem/progenitor. Monoubiquitinates SMAD4 and acts as an inhibitor of SMAD4-dependent TGF-beta/BMP signaling cascade (Monoubiquitination of SMAD4 hampers its ability to form a stable complex with activated SMAD2/3 resulting in inhibition of TGF- beta/BMP signaling cascade)
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
protein binding
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 1p13.1
SNPs TRIM33
Gene Sequence
>3384 bp
ATGGCGGAAAACAAAGGCGGCGGCGAGGCTGAGAGCGGCGGCGGGGGCAGCGGCAGCGCG
CCGGTAACTGCCGGGGCCGCCGGGCCCGCCGCGCAGGAGGCGGAGCCGCCTCTCACCGCG
GTGCTGGTGGAGGAGGAGGAGGAGGAAGGCGGCAGGGCCGGCGCTGAGGGCGGCGCGGCC
GGGCCCGACGACGGGGGGGTGGCCGCGGCCTCCTCGGGCTCGGCCCAGGCTGCTTCATCT
CCTGCGGCCTCAGTGGGCACTGGAGTTGCCGGGGGCGCAGTATCGACGCCGGCTCCAGCT
CCAGCCTCGGCTCCCGCTCCGGGTCCCTCGGCAGGGCCGCCTCCTGGACCGCCAGCCTCG
CTCCTGGACACCTGCGCCGTGTGTCAGCAGAGCTTGCAGAGCCGGCGTGAGGCGGAGCCC
AAGCTGCTGCCCTGTCTTCACTCCTTCTGCCTGCGCTGCCTGCCCGAGCCGGAGCGCCAG
CTCAGCGTGCCCATCCCGGGGGGCAGCAACGGCGACATCCAGCAAGTTGGTGTAATACGG
TGCCCAGTATGCCGCCAAGAATGCAGACAGATAGACCTTGTGGATAATTATTTTGTGAAA
GACACATCTGAAGCTCCTAGCAGTTCTGATGAAAAATCAGAACAGGTATGTACTAGTTGT
GAAGACAATGCAAGTGCAGTTGGCTTTTGTGTAGAATGTGGAGAGTGGCTATGTAAGACA
TGTATCGAAGCACATCAAAGAGTAAAATTTACTAAAGATCACTTGATCAGGAAGAAAGAA
GATGTCTCAGAGTCTGTTGGAGCATCTGGTCAACGCCCTGTTTTCTGCCCTGTACACAAA
CAAGAACAGTTGAAACTTTTCTGTGAAACATGTGATAGATTGACATGTAGAGACTGTCAG
CTATTGGAACACAAAGAACATAGGTATCAGTTTTTGGAAGAAGCTTTTCAAAATCAGAAG
GGTGCAATTGAGAATCTACTGGCGAAACTTCTTGAGAAGAAGAATTATGTTCATTTTGCA
GCTACTCAGGTGCAGAATAGGATAAAAGAAGTAAATGAGACTAACAAACGAGTAGAACAG
GAAATTAAAGTGGCCATTTTCACCCTTATCAATGAAATTAATAAGAAAGGAAAATCTCTC
TTACAACAGCTAGAGAATGTTACAAAGGAAAGACAGATGAAGTTACTACAGCAGCAGAAT
GACATCACAGGCCTTTCCCGGCAGGTGAAGCATGTTATGAACTTCACAAATTGGGCAATT
GCAAGTGGCAGCAGCACAGCACTACTATACAGCAAGCGACTGATTACTTTCCAGTTGCGT
CATATTTTGAAAGCACGGTGTGATCCTGTCCCTGCTGCTAATGGAGCAATACGTTTCCAT
TGTGATCCCACCTTCTGGGCAAAGAATGTAGTCAATTTAGGTAATCTAGTAATAGAGAGT
AAACCAGCTCCTGGTTATACTCCTAATGTTGTAGTTGGGCAAGTTCCTCCAGGGACAAAC
CACATTAGTAAAACCCCTGGACAGATTAACTTAGCACAGCTTCGACTCCAGCACATGCAA
CAACAAGTATATGCACAGAAACATCAGCAGTTGCAACAGATGAGGATGCAGCAACCACCA
GCACCTGTACCAACTACAACAACAACAACACAACAGCATCCTAGACAAGCAGCCCCTCAG
ATGTTACAACAACAGCCTCCTCGATTGATCAGTGTGCAAACAATGCAAAGAGGCAACATG
AACTGTGGAGCTTTTCAAGCCCATCAGATGAGACTGGCTCAGAATGCTGCCAGAATACCA
GGGATACCCAGGCACAGCGGCCCTCAATATTCCATGATGCAGCCACACCTCCAAAGACAA
CACTCAAACCCAGGGCATGCTGGACCCTTTCCCGTAGTATCGGTACACAACACCACAATC
AACCCAACGAGCCCTACTACAGCAACTATGGCAAATGCAAACCGAGGTCCCACCAGCCCA
TCTGTTACAGCAATAGAGCTAATCCCCTCAGTTACCAATCCAGAAAACCTTCCATCGCTG
CCAGATATTCCACCCATACAGTTGGAAGATGCTGGCTCAAGTAGTTTAGATAATCTACTA
AGTAGATACATCTCAGGCAGTCACCTACCCCCACAGCCTACAAGCACCATGAATCCTTCT
CCAGGTCCCTCTGCCCTTTCTCCGGGATCATCAGGTTTATCCAATTCTCACACACCTGTG
AGACCCCCAAGTACTTCTAGTACTGGCAGTCGAGGCAGCTGTGGGTCATCAGGAAGAACT
GCTGAGAAGACAAGTCTTAGTTTCAAATCTGATCAGGTGAAGGTCAAGCAAGAACCTGGG
ACTGAAGATGAAATATGTAGCTTTTCAGGAGGTGTAAAACAAGAAAAAACAGAGGATGGC
AGGAGGAGTGCTTGCATGTTGAGCAGTCCTGAGAGTAGCTTGACACCACCTCTCTCAACC
AACCTGCATCTAGAAAGTGAATTGGATGCATTGGCAAGCCTGGAAAACCATGTGAAAATT
GAACCTGCAGATATGAATGAAAGCTGCAAACAGTCAGGGCTCAGCAGCCTTGTTAATGGA
AAGTCCCCAATTCGAAGCCTCATGCACAGGTCGGCAAGGATTGGAGGAGATGGCAACAAT
AAAGATGATGACCCAAATGAAGACTGGTGTGCTGTCTGCCAAAACGGAGGAGATCTCTTG
TGCTGCGAAAAATGTCCAAAGGTCTTTCATCTAACTTGTCATGTTCCAACACTACTTAGC
TTTCCAAGTGGGGACTGGATATGCACATTTTGTAGAGATATTGGAAAGCCAGAAGTTGAA
TATGATTGTGATAATTTGCAACATAGTAAGAAGGGGAAAACTGCGCAGGGGTTAAGCCCC
GTGGACCAAAGGAAATGTGAACGTCTTCTGCTTTACCTCTATTGCCATGAATTAAGTATT
GAATTCCAGGAGCCTGTTCCTGCTTCGATACCAAACTACTATAAAATTATAAAGAAACCA
ATGGATTTATCCACCGTGAAAAAGAAGCTTCAGAAAAAACATTCCCAACACTACCAAATC
CCGGATGACTTTGTGGCCGATGTCCGTTTGATCTTCAAGAACTGTGAAAGGTTTAATGAA
ATGATGAAAGTTGTTCAAGTTTATGCAGACACACAAGAGATTAATTTGAAGGCTGATTCA
GAAGTAGCTCAGGCAGGGAAAGCAGTTGCATTGTACTTTGAAGATAAACTCACAGAGATC
TACTCAGACAGGACCTTCGCACCTTTGCCAGAGTTTGAGCAGGAAGAGGATGATGGTGAG
GTAACTGAGGACTCTGATGAAGACTTTATACAGCCCCGCAGAAAACGCCTAAAGTCAGAT
GAGAGACCAGTACATATAAAGTAA
Protein Properties
Number of Residues 1127
Molecular Weight 122520.2
Theoretical pI 6.65
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>E3 ubiquitin-protein ligase TRIM33
MAENKGGGEAESGGGGSGSAPVTAGAAGPAAQEAEPPLTAVLVEEEEEEGGRAGAEGGAA
GPDDGGVAAASSGSAQAASSPAASVGTGVAGGAVSTPAPAPASAPAPGPSAGPPPGPPAS
LLDTCAVCQQSLQSRREAEPKLLPCLHSFCLRCLPEPERQLSVPIPGGSNGDIQQVGVIR
CPVCRQECRQIDLVDNYFVKDTSEAPSSSDEKSEQVCTSCEDNASAVGFCVECGEWLCKT
CIEAHQRVKFTKDHLIRKKEDVSESVGASGQRPVFCPVHKQEQLKLFCETCDRLTCRDCQ
LLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRVEQ
EIKVAIFTLINEINKKGKSLLQQLENVTKERQMKLLQQQNDITGLSRQVKHVMNFTNWAI
ASGSSTALLYSKRLITFQLRHILKARCDPVPAANGAIRFHCDPTFWAKNVVNLGNLVIES
KPAPGYTPNVVVGQVPPGTNHISKTPGQINLAQLRLQHMQQQVYAQKHQQLQQMRMQQPP
APVPTTTTTTQQHPRQAAPQMLQQQPPRLISVQTMQRGNMNCGAFQAHQMRLAQNAARIP
GIPRHSGPQYSMMQPHLQRQHSNPGHAGPFPVVSVHNTTINPTSPTTATMANANRGPTSP
SVTAIELIPSVTNPENLPSLPDIPPIQLEDAGSSSLDNLLSRYISGSHLPPQPTSTMNPS
PGPSALSPGSSGLSNSHTPVRPPSTSSTGSRGSCGSSGRTAEKTSLSFKSDQVKVKQEPG
TEDEICSFSGGVKQEKTEDGRRSACMLSSPESSLTPPLSTNLHLESELDALASLENHVKT
EPADMNESCKQSGLSSLVNGKSPIRSLMHRSARIGGDGNNKDDDPNEDWCAVCQNGGDLL
CCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSP
VDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQI
PDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEI
YSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK
GenBank ID Protein 74027249
UniProtKB/Swiss-Prot ID Q9UPN9
UniProtKB/Swiss-Prot Entry Name TRI33_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015906.3
GeneCard ID TRIM33
GenAtlas ID TRIM33
HGNC ID HGNC:16290
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  5. Venturini L, You J, Stadler M, Galien R, Lallemand V, Koken MH, Mattei MG, Ganser A, Chambon P, Losson R, de The H: TIF1gamma, a novel member of the transcriptional intermediary factor 1 family. Oncogene. 1999 Feb 4;18(5):1209-17. [PubMed:10022127 ]
  6. Klugbauer S, Rabes HM: The transcription coactivator HTIF1 and a related protein are fused to the RET receptor tyrosine kinase in childhood papillary thyroid carcinomas. Oncogene. 1999 Jul 29;18(30):4388-93. [PubMed:10439047 ]
  7. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  8. Kikuno R, Nagase T, Ishikawa K, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Jun 30;6(3):197-205. [PubMed:10470851 ]
  9. He W, Dorn DC, Erdjument-Bromage H, Tempst P, Moore MA, Massague J: Hematopoiesis controlled by distinct TIF1gamma and Smad4 branches of the TGFbeta pathway. Cell. 2006 Jun 2;125(5):929-41. [PubMed:16751102 ]
  10. Reymond A, Meroni G, Fantozzi A, Merla G, Cairo S, Luzi L, Riganelli D, Zanaria E, Messali S, Cainarca S, Guffanti A, Minucci S, Pelicci PG, Ballabio A: The tripartite motif family identifies cell compartments. EMBO J. 2001 May 1;20(9):2140-51. [PubMed:11331580 ]
  11. Peng H, Feldman I, Rauscher FJ 3rd: Hetero-oligomerization among the TIF family of RBCC/TRIM domain-containing nuclear cofactors: a potential mechanism for regulating the switch between coactivation and corepression. J Mol Biol. 2002 Jul 12;320(3):629-44. [PubMed:12096914 ]
  12. Dupont S, Zacchigna L, Cordenonsi M, Soligo S, Adorno M, Rugge M, Piccolo S: Germ-layer specification and control of cell growth by Ectodermin, a Smad4 ubiquitin ligase. Cell. 2005 Apr 8;121(1):87-99. [PubMed:15820681 ]
  13. Dupont S, Mamidi A, Cordenonsi M, Montagner M, Zacchigna L, Adorno M, Martello G, Stinchfield MJ, Soligo S, Morsut L, Inui M, Moro S, Modena N, Argenton F, Newfeld SJ, Piccolo S: FAM/USP9x, a deubiquitinating enzyme essential for TGFbeta signaling, controls Smad4 monoubiquitination. Cell. 2009 Jan 9;136(1):123-35. doi: 10.1016/j.cell.2008.10.051. [PubMed:19135894 ]