You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09320
Secondary Accession Numbers
  • 15154
Name E3 ubiquitin-protein ligase ZNRF1
Synonyms
  1. Nerve injury-induced gene 283 protein
  2. Zinc/RING finger protein 1
Gene Name ZNRF1
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to substrates. May play a role in the establisment and maintenance of neuronal transmission and plasticity via its ubiquitin-protein ligase activity
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
protein binding
Cellular Location
  1. Peripheral membrane protein
  2. Lysosome
  3. Cytoplasmic vesicle
  4. Membrane
  5. secretory vesicle
  6. Peripheral membrane protein (Potential)
  7. Endosome
  8. synaptic vesicle membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 16q23.1
SNPs ZNRF1
Gene Sequence
>684 bp
ATGGGGGGCAAGCAGAGCACGGCGGCCCGCTCCCGGGGCCCCTTCCCGGGGGTCTCCACC
GATGACAGCGCCGTGCCGCCGCCGGGAGGGGCGCCCCATTTCGGGCACTACCGGACGGGC
GGCGGGGCCATGGGGCTGCGCAGCCGCTCGGTCAGCTCGGTGGCAGGCATGGGCATGGAC
CCCAGCACGGCCGGGGGGGTGCCCTTTGGCCTCTACACCCCCGCCTCCCGGGGCACCGGC
GACTCCGAGAGGGCGCCCGGCGGCGGAGGGTCTGCGTCCGACTCCACCTATGCCCATGGC
AATGGTTACCAGGAGACGGGCGGCGGTCACCATAGAGACGGGATGCTGTACCTGGGCTCC
CGAGCCTCGCTGGCGGATGCTCTACCTCTGCACATCGCACCCAGGTGGTTCAGCTCGCAT
AGTGGTTTCAAGTGCCCCATTTGCTCCAAGTCTGTGGCTTCTGACGAGATGGAAATGCAC
TTTATAATGTGTTTGAGCAAACCTCGCCTCTCCTACAACGATGATGTGCTGACTAAAGAC
GCGGGTGAGTGTGTGATCTGCCTGGAGGAGCTGCTGCAGGGGGACACGATAGCCAGGCTG
CCCTGCCTGTGCATCTATCACAAAAGCTGCATAGACTCGTGGTTTGAAGTGAACAGATCT
TGTCCGGAACACCCTGCGGACTGA
Protein Properties
Number of Residues 227
Molecular Weight 23782.4
Theoretical pI 6.66
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>E3 ubiquitin-protein ligase ZNRF1
MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMD
PSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGS
RASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKD
AGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD
GenBank ID Protein 14583079
UniProtKB/Swiss-Prot ID Q8ND25
UniProtKB/Swiss-Prot Entry Name ZNRF1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF378524
GeneCard ID ZNRF1
GenAtlas ID ZNRF1
HGNC ID HGNC:18452
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  4. Araki T, Milbrandt J: ZNRF proteins constitute a family of presynaptic E3 ubiquitin ligases. J Neurosci. 2003 Oct 15;23(28):9385-94. [PubMed:14561866 ]
  5. Araki T, Nagarajan R, Milbrandt J: Identification of genes induced in peripheral nerve after injury. Expression profiling and novel gene discovery. J Biol Chem. 2001 Sep 7;276(36):34131-41. Epub 2001 Jun 26. [PubMed:11427537 ]