Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09325
Secondary Accession Numbers
  • 15162
Name E3 ubiquitin-protein ligase LRSAM1
Synonyms
  1. Leucine-rich repeat and sterile alpha motif-containing protein 1
  2. Tsg101-associated ligase
  3. hTAL
Gene Name LRSAM1
Protein Type Enzyme
Biological Properties
General Function Involved in hormone activity
Specific Function E3 ubiquitin-protein ligase that mediates monoubiquitination of TSG101 at multiple sites, leading to inactivate the ability of TSG101 to sort endocytic (EGF receptors) and exocytic (HIV-1 viral proteins) cargos
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Function
hormone activity
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
protein binding
receptor binding
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:9
Locus 9q33.3
SNPs LRSAM1
Gene Sequence
>2172 bp
ATGCCGCTCTTCTTCCGGAAGCGGAAACCCAGTGAGGAGGCTCGGAAACGCCTGGAGTAC
CAGATGTGTTTGGCAAAAGAAGCTGGGGCAGATGACATTCTCGACATCTCTAAATGTGAG
CTCTCAGAGATTCCATTTGGAGCTTTTGCAACATGCAAAGTTCTGCAGAAGAAGGTGCTG
ATCGTCCACACGAATCACCTCACTTCCCTGCTTCCCAAATCCTGCAGCCTCCTGAGTCTG
GCAACCATCAAGGTTCTAGATCTCCACGATAATCAGCTGACAGCCCTTCCTGACGATCTG
GGGCAGCTGACTGCCCTCCAGGTCTTAAACGTGGAAAGGAATCAACTGATGCAGCTCCCA
CGTTCCATTGGGAACCTGACCCAGCTCCAGACTCTCAATGTTAAAGACAACAAGCTGAAG
GAGCTTCCAGACACCGTGGGGGAGCTTCGAAGCCTGCGTACCCTCAACATCAGTGGAAAC
GAGATCCAGAGATTGCCGCAGATGCTGGCTCACGTTCGAACCCTGGAGATGCTGAGCCTT
GACGCCTCGGCCATGGTCTACCCGCCGCGGGAGGTGTGTGGTGCCGGCACTGCGGCCATC
TTGCAGTTCCTCTGCAAAGAGTCAGGGCTGGAATACTACCCCCCTTCTCAGTACTTGCTG
CCAATTCTGGAGCAAGATGGAATCGAGAACTCTCGGGACAGCCCTGATGGGCCCACGGAC
AGATTCTCAAGGGAGGAGTTAGAGTGGCAGAACAGGTTCTCAGACTATGAGAAGAGGAAG
GAACAGAAGATGCTGGAGAAACTCGAGTTTGAACGGCGCCTGGAACTGGGGCAGCGGGAG
CACACCCAGCTCCTTCAGCAGAGCAGCAGCCAGAAGGATGAGATCCTTCAGACGGTCAAG
GAGGAGCAGTCCCGGCTGGAGCAGGGCCTGAGTGAGCACCAGCGCCACCTCAACGCAGAG
CGGCAGCGGCTGCAGGAGCAGCTGAAGCAGACGGAACAGAACATTTCCAGCCGGATCCAG
AAGCTGCTGCAGGACAATCAGAGACAAAAGAAAAGCTCCGAGATTTTGAAATCGCTGGAA
AATGAAAGAATAAGAATGGAACAGTTGATGTCCATAACCCAGGAGGAGACTGAGAGCCTG
CGGCGACGTGACGTTGCCTCCGCCATGCAGCAGATGCTGACTGAGAGCTGTAAGAACCGG
CTCATCCAGATGGCCTACGAATCTCAGAGGCAGAACTTGGTCCAGCAGGCCTGTTCCAGC
ATGGCCGAAATGGATGAACGATTCCAGCAGATTCTGTCGTGGCAGCAAATGGATCAGAAC
AAAGCCATCAGCCAGATCCTGCAGGAGAGCGCGATGCAGAAGGCTGCGTTCGAGGCACTC
CAGGTGAAGAAAGACCTGATGCATCGGCAGATCAGGAGCCAGATTAAGTTAATAGAAACT
GAGTTATTGCAGCTGACACAGCTGGAGTTAAAGAGGAAGTCCCTGGACACAGAGTCACTC
CAGGAGATGATCTCGGAGCAGCGCTGGGCCCTCAGCTCCCTGCTCCAGCAGCTGCTCAAA
GAGAAGCAGCAGCGAGAGGAAGAGCTCCGGGAAATCCTGACGGAGTTAGAAGCCAAAAGT
GAAACCAGGCAGGAAAATTACTGGCTGATTCAGTATCAACGGCTTTTGAACCAGAAGCCC
TTGTCCTTGAAGCTGCAAGAAGAGGGGATGGAGCGCCAGCTGGTGGCCCTCCTGGAGGAG
CTGTCGGCTGAGCACTACCTGCCCATCTTTGCGCACCACCGCCTCTCACTGGACCTGCTG
AGCCAAATGAGCCCAGGGGACCTGGCCAAGGTGGGCGTCTCAGAAGCTGGCCTGCAGCAC
GAGATCCTCCGGAGAGTCCAGGAACTGCTGGATGCAGCCAGGATCCAGCCAGAGCTGAAA
CCACCAATGGGTGAGGTCGTCACCCCTACGGCCCCCCAGGAGCCTCCTGAGTCTGTGAGG
CCATCCGCTCCCCCTGCAGAGCTGGAGGTGCAGGCCTCAGAGTGTGTCGTGTGCCTGGAA
CGGGAGGCCCAGATGATCTTCCTCAACTGTGGCCACGTCTGCTGCTGCCAGCAGTGCTGC
CAGCCACTGCGCACCTGCCCGCTGTGCCGCCAGGACATCGCCCAGCGCCTCCGCATCTAC
CACAGCAGCTGA
Protein Properties
Number of Residues 723
Molecular Weight 83593.1
Theoretical pI 5.75
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>E3 ubiquitin-protein ligase LRSAM1
MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPFGAFATCKVLQKKVL
IVHTNHLTSLLPKSCSLLSLATIKVLDLHDNQLTALPDDLGQLTALQVLNVERNQLMQLP
RSIGNLTQLQTLNVKDNKLKELPDTVGELRSLRTLNISGNEIQRLPQMLAHVRTLEMLSL
DASAMVYPPREVCGAGTAAILQFLCKESGLEYYPPSQYLLPILEQDGIENSRDSPDGPTD
RFSREELEWQNRFSDYEKRKEQKMLEKLEFERRLELGQREHTQLLQQSSSQKDEILQTVK
EEQSRLEQGLSEHQRHLNAERQRLQEQLKQTEQNISSRIQKLLQDNQRQKKSSEILKSLE
NERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQACSS
MAEMDERFQQILSWQQMDQNKAISQILQESAMQKAAFEALQVKKDLMHRQIRSQIKLIET
ELLQLTQLELKRKSLDTESLQEMISEQRWALSSLLQQLLKEKQQREEELREILTELEAKS
ETRQENYWLIQYQRLLNQKPLSLKLQEEGMERQLVALLEELSAEHYLPIFAHHRLSLDLL
SQMSPGDLAKVGVSEAGLQHEILRRVQELLDAARIQPELKPPMGEVVTPTAPQEPPESVR
PSAPPAELEVQASECVVCLEREAQMIFLNCGHVCCCQQCCQPLRTCPLCRQDIAQRLRIY
HSS
GenBank ID Protein 53729361
UniProtKB/Swiss-Prot ID Q6UWE0
UniProtKB/Swiss-Prot Entry Name LRSM1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001005373.2
GeneCard ID LRSAM1
GenAtlas ID LRSAM1
HGNC ID HGNC:25135
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  5. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  6. Carlton JG, Martin-Serrano J: Parallels between cytokinesis and retroviral budding: a role for the ESCRT machinery. Science. 2007 Jun 29;316(5833):1908-12. Epub 2007 Jun 7. [PubMed:17556548 ]
  7. Amit I, Yakir L, Katz M, Zwang Y, Marmor MD, Citri A, Shtiegman K, Alroy I, Tuvia S, Reiss Y, Roubini E, Cohen M, Wides R, Bacharach E, Schubert U, Yarden Y: Tal, a Tsg101-specific E3 ubiquitin ligase, regulates receptor endocytosis and retrovirus budding. Genes Dev. 2004 Jul 15;18(14):1737-52. [PubMed:15256501 ]