Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09328
Secondary Accession Numbers
  • 15165
Name Probable E3 ubiquitin-protein ligase TRIP12
Synonyms
  1. TR-interacting protein 12
  2. TRIP-12
  3. Thyroid receptor-interacting protein 12
Gene Name TRIP12
Protein Type Enzyme
Biological Properties
General Function Involved in binding
Specific Function Component of PA700, an ATP-dependent multisubunit protein that activates the proteolytic activities of the multifunctional proteinase (20S proteasome) of the 26S complex. Specifically interacts with the ligand binding domain of the thyroid hormone receptor (in a thyroid hormone T3-independent manner) and with retinoid X receptor (RXR). Could be E3 ubiquitin- protein ligase which accepts ubiquitin from an E2 ubiquitin- conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
binding
catalytic activity
ligase activity
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 2q36.3
SNPs TRIP12
Gene Sequence
>5979 bp
ATGTCCAACCGGCCTAATAACAATCCAGGGGGGTCACTGCGACGTTCACAGAGGAACACT
GCCGGGGCCCAACCACAAGACGACTCAATAGGAGGAAGAAGCTGCAGTTCATCATCTGCT
GTGATAGTTCCACAACCAGAGGATCCAGACAGAGCCAATACTTCAGAAAGACAAAAAACG
GGGCAGGTGCCTAAGAAAGACAATTCTCGAGGAGTGAAGCGCAGTGCTAGTCCAGACTAC
AACAGGACCAATTCTCCTAGCTCTGCAAAAAAACCAAAAGCACTTCAGCATACTGAATCT
CCCTCAGAAACAAATAAGCCACATAGTAAGTCAAAGAAGAGACATTTAGACCAGGAGCAA
CAACTGAAATCTGCACAATCACCATCAACAAGCAAGGCTCATACCAGGAAGAGTGGGGCC
ACTGGCGGTTCACGGAGTCAGAAAAGAAAAAGGACAGAGAGTTCTTGTGTAAAGAGTGGC
TCCGGGTCTGAATCAACTGGTGCAGAAGAGAGATCTGCGAAACCTACCAAGCTGGCTTCA
AAATCAGCCACCTCAGCCAAAGCTGGGTGTAGCACCATCACTGATTCTTCTTCTGCTGCC
TCTACTTCCTCCTCGTCTTCTGCTGTAGCCTCGGCCTCCTCCACTGTACCACCAGGTGCC
AGAGTGAAACAAGGAAAAGATCAGAACAAGGCCAGGCGTTCCCGTTCAGCGTCCAGTCCC
AGCCCCAGAAGAAGTAGCAGGGAAAAGGAACAGAGTAAAACTGGTGGCTCTTCAAAATTT
GATTGGGCTGCTCGTTTCAGCCCTAAAGTTAGCCTTCCTAAAACAAAACTGTCTCTTCCA
GGGTCTTCTAAGTCAGAGACATCAAAACCTGGACCTTCTGGATTACAGGCCAAATTAGCA
AGTTTAAGAAAATCTACGAAGAAACGCAGTGAGTCTCCACCTGCTGAGCTCCCCAGTTTG
AGGCGGAGCACACGCCAAAAGACCACGGGCTCCTGTGCTAGTACCAGTCGGCGAGGCTCT
GGCCTGGGCAAAAGAGGAGCAGCTGAAGCTCGTCGACAGGAGAAAATGGCAGACCCTGAA
AGCAACCAGGAGGCAGTAAATTCTTCAGCTGCTCGGACAGATGAAGCTCCCCAAGGAGCT
GCAGGGGCTGTTGGCATGACCACCTCTGGGGAGAGTGAATCAGATGATTCCGAGATGGGA
CGTTTGCAAGCTTTGTTAGAGGCAAGGGGTCTTCCCCCTCACCTATTTGGTCCTCTTGGT
CCTCGGATGTCACAGCTTTTCCATAGAACAATTGGAAGTGGAGCTAGTTCTAAGGCCCAG
CAGCTACTACAAGGATTGCAAGCCAGTGATGAAAGTCAACAGCTTCAGGCAGTTATTGAG
ATGTGTCAGTTACTGGTCATGGGAAATGAGGAGACACTGGGAGGGTTTCCTGTCAAGAGT
GTTGTTCCAGCTTTGATTACGTTACTTCAGATGGAGCACAATTTTGATATTATGAACCAT
GCTTGTCGAGCCTTAACATACATGATGGAAGCACTTCCTCGATCTTCTGCTGTTGTAGTA
GATGCTATTCCTGTCTTTTTAGAAAAGCTGCAAGTTATTCAGTGTATTGATGTGGCAGAG
CAGGCCTTGACTGCCTTGGAGATGTTGTCACGGAGACATAGTAAAGCCATTCTACAGGCG
GGTGGTTTGGCAGACTGCTTGCTGTACCTAGAATTCTTCAGCATAAATGCCCAAAGAAAT
GCATTAGCAATTGCAGCTAATTGCTGCCAGAGTATCACGCCAGATGAATTTCATTTTGTG
GCAGATTCACTCCCATTGCTAACCCAAAGGCTAACACATCAGGATAAAAAGTCAGTAGAA
AGCACTTGCCTTTGTTTTGCACGCCTAGTGGACAACTTCCAGCATGAGGAGAATTTACTC
CAGCAGGTTGCTTCCAAAGATCTGCTTACAAATGTTCAACAGCTGTTGGTAGTGACTCCA
CCCATTTTAAGTTCTGGGATGTTTATAATGGTGGTTCGCATGTTTTCTCTGATGTGTTCC
AACTGTCCAACTTTAGCTGTTCAACTTATGAAACAAAACATTGCAGAAACGCTTCACTTT
CTCCTGTGTGGTGCCTCCAATGGAAGTTGTCAGGAACAGATTGATCTTGTTCCACGAAGC
CCTCAAGAGTTGTATGAACTGACATCTCTGATTTGTGAACTTATGCCATGTTTACCAAAA
GAAGGCATTTTTGCAGTTGATACCATGTTGAAGAAGGGAAATGCACAGAACACAGATGGT
GCGATATGGCAGTGGCGTGATGATCGGGGCCTCTGGCATCCATATAACAGGATTGACAGC
CGGATCATTGAGCAAATCAATGAGGACACGGGAACAGCACGTGCCATTCAGAGAAAACCT
AACCCGTTAGCCAATAGTAACACTAGTGGATATTCAGAGTCAAAGAAGGATGATGCTCGA
GCACAGCTTATGAAAGAGGATCCGGAACTGGCTAAGTCTTTTATTAAGACATTATTTGGT
GTTCTTTATGAAGTGTATAGTTCCTCAGCAGGACCTGCGGTCAGACATAAGTGCCTTAGA
GCAATTCTTAGGATAATTTATTTTGCGGATGCTGAACTTCTGAAGGATGTTCTGAAAAAT
CATGCTGTTTCAAGTCACATTGCTTCCATGCTGTCAAGCCAAGACCTGAAGATAGTAGTG
GGAGCACTTCAGATGGCAGAAATTTTAATGCAGAAGTTACCTGATATTTTTAGTGTTTAC
TTCAGAAGAGAAGGTGTAATGCATCAAGTAAAACACTTAGCAGAATCAGAGTCTTTGTTG
ACAAGTCCACCAAAGGCATGTACGAATGGATCGGGATCCATGGGATCCACAACTTCAGTC
AGCAGTGGGACAGCCACAGCTGCCACTCATGCTGCAGCTGACTTGGGATCACCCAGCTTG
CAGCACAGCAGGGATGATTCTTTAGATCTCAGCCCTCAAGGTCGATTAAGTGATGTTCTA
AAGAGAAAACGACTGCCAAAACGAGGGCCAAGAAGGCCAAAGTACTCACCTCCAAGAGAT
GATGACAAAGTAGACAATCAAGCTAAAAGCCCCACCACTACTCAGTCACCTAAATCTTCT
TTCCTGGCAAGCTTGAATCCAAAAACATGGGGAAGGTTAAGTACACAGTCCAACAGCAAC
AACATTGAGCCAGCACGGACTGCGGGAGGTAGTGGCCTTGCCAGGGCTGCCTCAAAGGAT
ACCATCTCCAATAATAGAGAAAAAATTAAAGGTTGGATTAAGGAGCAGGCACATAAATTT
GTAGAACGTTATTTCAGTTCTGAGAATATGGATGGAAGCAACCCTGCATTGAATGTCCTT
CAGAGACTTTGTGCTGCAACCGAACAACTCAACCTCCAGGTGGATGGTGGAGCTGAGTGC
CTTGTAGAAATCCGTAGCATAGTCTCAGAGTCAGATGTTTCATCATTTGAAATCCAACAT
AGTGGATTTGTGAAGCAGCTGTTGCTTTATTTGACATCTAAAAGTGAAAAGGATGCTGTG
AGCAGAGAGATCAGATTAAAGCGATTTCTTCATGTATTTTTTTCTTCTCCACTTCCTGGA
GAAGAGCCCATTGGAAGAGTGGAACCAGTGGGTAATGCACCTTTGTTGGCATTAGTTCAC
AAGATGAACAACTGCCTCAGCCAGATGGAACAATTTCCAGTCAAAGTACATGATTTCCCT
AGTGGAAATGGGACAGGAGGCAGCTTTTCTCTCAACAGAGGATCACAGGCTTTAAAATTT
TTCAACACACATCAATTAAAATGCCAGTTACAAAGGCATCCAGACTGTGCAAATGTGAAG
CAGTGGAAGGGTGGACCTGTCAAGATTGACCCTCTGGCTTTGGTACAAGCCATCGAGAGA
TACCTTGTAGTTAGAGGGTATGGAAGAGTAAGAGAAGATGATGAAGACAGCGATGACGAT
GGATCAGATGAGGAAATAGATGAGTCTCTGGCTGCTCAGTTCCTAAATTCAGGAAATGTA
AGACACAGGCTGCAGTTTTATATTGGAGAACATTTGCTGCCGTATAACATGACTGTGTAT
CAGGCAGTACGGCAGTTTAGTATACAGGCTGAAGATGAAAGAGAATCCACAGATGATGAG
AGCAATCCTCTAGGCAGAGCTGGTATTTGGACAAAGACTCATACAATATGGTATAAACCT
GTGAGAGAGGATGAAGAAAGTAATAAAGATTGTGTTGGTGGTAAAAGAGGAAGAGCCCAA
ACAGCTCCAACGAAAACTTCCCCTAGAAATGCAAAAAAGCATGATGAGTTATGGCACGAT
GGAGTGTGCCCATCAGTATCAAATCCTTTAGAAGTTTACCTCATTCCCACACCACCTGAA
AATATAACATTTGAAGACCCGTCATTAGATGTGATCCTTCTTTTAAGAGTTTTACATGCT
ATCAGTCGATACTGGTATTACTTGTATGATAATGCAATGTGCAAGGAAATTATTCCAACT
AGTGAATTTATTAACAGTAAGTTAACAGCAAAAGCAAATAGGCAACTTCAAGATCCTTTA
GTAATCATGACAGGAAACATCCCAACATGGCTTACTGAGCTAGGAAAAACCTGCCCATTT
TTCTTTCCTTTTGATACCCGGCAAATGCTTTTTTATGTAACTGCATTTGATCGGGACCGA
GCAATGCAAAGATTACTTGATACCAACCCAGAAATCAACCAGTCTGATTCTCAAGATAGC
AGAGTTGCACCTAGATTGGATAGAAAAAAACGTACTGTGAACCGAGAGGAGCTGCTGAAA
CAGGCGGAGTCTGTGATGCAGGACCTCGGCAGCTCACGGGCCATGTTAGAAATCCAGTAT
GAAAATGAGGTTGGTACAGGTCTTGGGCCTACACTGGAGTTTTATGCGCTTGTATCTCAG
GAACTACAGAGAGCTGACTTGGGTCTTTGGAGAGGTGAAGAAGTAACTCTTAGCAATCCA
AAAGGGAGCCAAGAAGGGACCAAGTATATTCAAAACCTCCAGGGCCTGTTTGCGCTTCCC
TTTGGTAGGACAGCAAAGCCAGCTCATATCGCAAAGGTTAAGATGAAGTTTCGCTTCTTA
GGAAAATTAATGGCCAAGGCTATCATGGATTTCAGATTGGTGGACCTTCCCCTTGGCTTA
CCCTTTTATAAATGGATGCTACGGCAAGAAACTTCACTGACATCACACGATTTGTTTGAC
ATCGACCCAGTTGTAGCCAGATCAGTTTATCACCTAGAAGACATTGTCAGACAGAAGAAA
AGACTTGAACAAGATAAATCCCAGACCAAAGAGAGTCTACAGTATGCATTAGAAACCTTG
ACTATGAATGGCTGCTCAGTTGAAGATCTAGGACTGGATTTCACTCTGCCAGGGTTTCCC
AATATCGAACTGAAGAAAGGAGGGAAGGATATACCAGTCACTATCCACAATTTAGAGGAG
TATCTAAGACTGGTTATATTCTGGGCACTAAATGAAGGCGTTTCTAGGCAATTTGATTCG
TTCAGAGATGGATTTGAATCAGTCTTCCCACTCAGTCATCTTCAGTACTTCTACCCGGAG
GAACTGGATCAGCTCCTTTGTGGCAGTAAAGCAGACACTTGGGATGCAAAGACACTGATG
GAATGCTGTAGGCCTGATCATGGTTATACTCATGACAGTCGGGCTGTGAAGTTTTTGTTT
GAGATTCTCAGTAGTTTTGATAATGAGCAGCAGAGGTTATTTCTCCAGTTTGTGACTGGT
AGCCCAAGATTGCCTGTTGGAGGATTCCGGAGTTTGAATCCACCTTTGACAATTGTCCGA
AAGACGTTTGAATCAACAGAAAACCCAGATGACTTCTTGCCCTCTGTAATGACTTGTGTG
AACTATCTTAAGTTGCCGGACTATTCAAGCATTGAGATAATGCGTGAAAAACTGTTGATA
GCAGCAAGAGAAGGGCAGCAGTCGTTCCATCTTTCCTGA
Protein Properties
Number of Residues 1992
Molecular Weight 220431.5
Theoretical pI 8.64
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Probable E3 ubiquitin-protein ligase TRIP12
MSNRPNNNPGGSLRRSQRNTAGAQPQDDSIGGRSCSSSSAVIVPQPEDPDRANTSERQKT
GQVPKKDNSRGVKRSASPDYNRTNSPSSAKKPKALQHTESPSETNKPHSKSKKRHLDQEQ
QLKSAQSPSTSKAHTRKSGATGGSRSQKRKRTESSCVKSGSGSESTGAEERSAKPTKLAS
KSATSAKAGCSTITDSSSAASTSSSSSAVASASSTVPPGARVKQGKDQNKARRSRSASSP
SPRRSSREKEQSKTGGSSKFDWAARFSPKVSLPKTKLSLPGSSKSETSKPGPSGLQAKLA
SLRKSTKKRSESPPAELPSLRRSTRQKTTGSCASTSRRGSGLGKRGAAEARRQEKMADPE
SNQEAVNSSAARTDEAPQGAAGAVGMTTSGESESDDSEMGRLQALLEARGLPPHLFGPLG
PRMSQLFHRTIGSGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKS
VVPALITLLQMEHNFDIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAE
QALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFV
ADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTP
PILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRS
PQELYELTSLICELMPCLPKEGIFAVDTMLKKGNAQNTDGAIWQWRDDRGLWHPYNRIDS
RIIEQINEDTGTARAIQRKPNPLANSNTSGYSESKKDDARAQLMKEDPELAKSFIKTLFG
VLYEVYSSSAGPAVRHKCLRAILRIIYFADAELLKDVLKNHAVSSHIASMLSSQDLKIVV
GALQMAEILMQKLPDIFSVYFRREGVMHQVKHLAESESLLTSPPKACTNGSGSMGSTTSV
SSGTATAATHAAADLGSPSLQHSRDDSLDLSPQGRLSDVLKRKRLPKRGPRRPKYSPPRD
DDKVDNQAKSPTTTQSPKSSFLASLNPKTWGRLSTQSNSNNIEPARTAGGSGLARAASKD
TISNNREKIKGWIKEQAHKFVERYFSSENMDGSNPALNVLQRLCAATEQLNLQVDGGAEC
LVEIRSIVSESDVSSFEIQHSGFVKQLLLYLTSKSEKDAVSREIRLKRFLHVFFSSPLPG
EEPIGRVEPVGNAPLLALVHKMNNCLSQMEQFPVKVHDFPSGNGTGGSFSLNRGSQALKF
FNTHQLKCQLQRHPDCANVKQWKGGPVKIDPLALVQAIERYLVVRGYGRVREDDEDSDDD
GSDEEIDESLAAQFLNSGNVRHRLQFYIGEHLLPYNMTVYQAVRQFSIQAEDERESTDDE
SNPLGRAGIWTKTHTIWYKPVREDEESNKDCVGGKRGRAQTAPTKTSPRNAKKHDELWHD
GVCPSVSNPLEVYLIPTPPENITFEDPSLDVILLLRVLHAISRYWYYLYDNAMCKEIIPT
SEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDR
AMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVMQDLGSSRAMLEIQY
ENEVGTGLGPTLEFYALVSQELQRADLGLWRGEEVTLSNPKGSQEGTKYIQNLQGLFALP
FGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFD
IDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFP
NIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQYFYPE
ELDQLLCGSKADTWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTG
SPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLI
AAREGQQSFHLS
GenBank ID Protein 10863903
UniProtKB/Swiss-Prot ID Q14669
UniProtKB/Swiss-Prot Entry Name TRIPC_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004238.1
GeneCard ID TRIP12
GenAtlas ID TRIP12
HGNC ID HGNC:12306
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  8. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  9. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  10. Wang Y, Du D, Fang L, Yang G, Zhang C, Zeng R, Ullrich A, Lottspeich F, Chen Z: Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling. EMBO J. 2006 Nov 1;25(21):5058-70. Epub 2006 Oct 19. [PubMed:17053785 ]
  11. Nomura N, Nagase T, Miyajima N, Sazuka T, Tanaka A, Sato S, Seki N, Kawarabayasi Y, Ishikawa K, Tabata S: Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1994;1(5):223-9. [PubMed:7584044 ]
  12. Lee JW, Choi HS, Gyuris J, Brent R, Moore DD: Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor. Mol Endocrinol. 1995 Feb;9(2):243-54. [PubMed:7776974 ]