You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09334
Secondary Accession Numbers
  • 15173
Name Glucosamine-6-phosphate isomerase 2
Synonyms
  1. GNPDA 2
  2. GlcN6P deaminase 2
  3. Glucosamine-6-phosphate deaminase 2
  4. Glucosamine-6-phosphate isomerase SB52
Gene Name GNPDA2
Protein Type Enzyme
Biological Properties
General Function Involved in carbohydrate metabolic process
Specific Function Not Available
Pathways
  • Amino sugar and nucleotide sugar metabolism
Reactions
Glucosamine 6-phosphate + Water → Fructose 6-phosphate + Ammonia details
GO Classification
Biological Process
N-acetylglucosamine metabolic process
carbohydrate metabolic process
Cellular Component
cytoplasm
Function
catalytic activity
isomerase activity
intramolecular oxidoreductase activity
intramolecular oxidoreductase activity, interconverting aldoses and ketoses
glucosamine-6-phosphate deaminase activity
Molecular Function
glucosamine-6-phosphate deaminase activity
hydrolase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
amino sugar metabolic process
glucosamine metabolic process
n-acetylglucosamine metabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 4
Locus 4p12
SNPs GNPDA2
Gene Sequence
>831 bp
ATGAGGCTTGTAATTCTTGATAACTATGACTTGGCTAGTGAATGGGCAGCCAAATACATC
TGTAATCGCATCATTCAGTTCAAACCTGGACAGGACAGATATTTTACACTGGGTTTACCA
ACAGGGAGTACACCTTTAGGATGCTATAAAAAACTAATAGAATATCATAAGAATGGACAC
CTTTCTTTTAAATATGTGAAGACCTTTAATATGGATGAATATGTAGGACTTCCAAGAAAT
CATCCTGAAAGCTACCATTCTTATATGTGGAATAATTTTTTTAAGCATATCGATATAGAT
CCTAATAATGCACATATCCTTGACGGGAATGCTGCAGATTTACAAGCAGAATGTGATGCT
TTTGAAAACAAAATAAAAGAAGCTGGAGGAATAGATCTTTTTGTTGGAGGAATTGGTCCA
GATGGTCATATCGCTTTCAATGAGCCTGGATCCAGTTTAGTGTCAAGGACAAGATTAAAG
ACTCTAGCAATGGATACCATCTTGGCAAATGCCAAATATTTTGATGGAGATTTATCAAAA
GTGCCAACTATGGCTCTAACTGTTGGTGTGGGGACAGTGATGGATGCTAGAGAAGTAATG
ATCCTTATAACAGGGGCACACAAGGCATTTGCCCTGTACAAAGCAATAGAAGAAGGAGTC
AATCACATGTGGACTGTTTCCGCTTTCCAGCAGCATCCCCGGACTATTTTTGTATGCGAT
GAAGATGCTACTTTAGAATTAAGAGTTAAAACTGTGAAATACTTTAAAGGTCTAATGCAT
GTGCACAATAAACTTGTGGATCCACTATTCAGTATGAAAGATGGAAACTGA
Protein Properties
Number of Residues 276
Molecular Weight 27090.845
Theoretical pI 6.525
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Glucosamine-6-phosphate isomerase 2
MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGH
LSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDA
FENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSK
VPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCD
EDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8TDQ7
UniProtKB/Swiss-Prot Entry Name GNPI2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF247786
GeneCard ID GNPDA2
GenAtlas ID GNPDA2
HGNC ID HGNC:21526
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Arreola R, Valderrama B, Morante ML, Horjales E: Two mammalian glucosamine-6-phosphate deaminases: a structural and genetic study. FEBS Lett. 2003 Sep 11;551(1-3):63-70. [PubMed:12965206 ]
  5. Zhang J, Zhang W, Zou D, Chen G, Wan T, Li N, Cao X: Cloning and functional characterization of GNPI2, a novel human homolog of glucosamine-6-phosphate isomerase/oscillin. J Cell Biochem. 2003 Apr 1;88(5):932-40. [PubMed:12616532 ]