You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09352
Secondary Accession Numbers
  • 15202
Name Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase
Synonyms
  1. NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase
  2. ST6GalNAc IV
  3. Sialyltransferase 3C
  4. Sialyltransferase 7D
  5. ST6GalNAcIV
  6. SIAT3-C
  7. SIAT7-D
Gene Name ST6GALNAC4
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Involved in the biosynthesis of ganglioside GD1A from GM1B. Transfers CMP-NeuAc with an alpha-2,6-linkage to GalNAc residue on NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc of glycoproteins and glycolipids. Prefers glycoproteins to glycolipids (By similarity).
Pathways
  • Glycosphingolipid biosynthesis - ganglio series
  • protein glycosylation
Reactions
Cytidine 5'-monophosphate-N-acetylneuraminic acid + N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-D-galactosaminyl-R → Cytidine monophosphate + N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-(N-acetyl-alpha-neuraminyl-(2->6))-N-acetyl-D-galactosaminyl-R details
CMP-N-acetylneuraminate + GM1b → CMP + GD1a details
GO Classification
Biological Process
O-glycan processing
post-translational protein modification
glycolipid metabolic process
Cellular Component
nucleus
integral to Golgi membrane
Golgi membrane
Component
membrane
intrinsic to membrane
intrinsic to organelle membrane
intrinsic to golgi membrane
integral to golgi membrane
cell
Function
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
sialyltransferase activity
Molecular Function
sialyltransferase activity
(alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl-galactosaminide 6-alpha-sialyltransferase activity
Process
biopolymer metabolism
biopolymer modification
protein modification
physiological process
metabolism
macromolecule metabolism
protein amino acid glycosylation
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus 9q34
SNPs Q5T9D0
Gene Sequence
>909 bp
ATGAAGGCTCCGGGTCGGCTCGTGCTCATCATCCTGTGCTCCGTGGTCTTCTCTGCCGTC
TACATCCTCCTGTGCTGCTGGGCCGGCCTGCCCCTCTGCCTGGCCACCTGCCTGGACCAC
CACTTCCCCACAGGCTCCAGGCCCACTGTGCCGGGACCCCTGCACTTCAGTGGATATAGC
AGTGTGCCAGATGGGAAGCCGCTGGTCCGCGAGCCCTGCCGCAGCTGTGCCGTGGTGTCC
AGCTCCGGCCAAATGCTGGGCTCAGGCCTGGGTGCTGAGATCGACAGTGCCGAGTGCGTG
TTCCGCATGAACCAGGCGCCCACCGTGGGCTTTGAGGCGGATGTGGGCCAGCGCAGCACC
CTGCGTGTCGTCTCACACACAAGCGTGCCGCTGCTGCTGCGCAACTATTCACACTACTTC
CAGAAGGCCCGAGACACGCTCTACATGGTGTGGGGCCAGGGCAGGCACATGGACCGGGTG
CTCGGCGGCCGCACCTACCGCACGCTGCTGCAGCTCACCAGGATGTACCCCGGCCTGCAG
GTGTACACCTTCACGGAGCGCATGATGGCCTACTGCGACCAGATCTTCCAGGACGAGACG
GGCAAGAACCGGAGGCAGTCGGGCTCCTTCCTCAGCACCGGCTGGTTCACCATGATCCTC
GCGCTGGAGCTGTGTGAGGAGATCGTGGTCTATGGGATGGTCAGCGACAGCTACTGCAGG
GAGAAGAGCCACCCCTCAGTGCCTTACCACTACTTTGAGAAGGGCCGGCTAGATGAGTGT
CAGATGTACCTGGCACACGAGCAGGCGCCCCGAAGCGCCCACCGCTTCATCACTGAGAAG
GCGGTCTTCTCCCGCTGGGCCAAGAAGAGGCCCATCGTGTTCGCCCATCCGTCCTGGAGG
ACTGAGTAG
Protein Properties
Number of Residues 302
Molecular Weight 34200.255
Theoretical pI 8.569
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>ST6 neuraminyl-2,3-beta-galactosyl-1,3-N-acetylgalactosaminide alpha- 2,6-sialyltransferase 4 (ST6 (Alpha-N-acetyl-neuraminyl-2,3-beta- galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4, isoform CRA_a)
MKAPGRLVLIILCSVVFSAVYILLCCWAGLPLCLATCLDHHFPTGSRPTVPGPLHFSGYS
SVPDGKPLVREPCRSCAVVSSSGQMLGSGLGAEIDSAECVFRMNQAPTVGFEADVGQRST
LRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQ
VYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCR
EKSHPSVPYHYFEKGRLDECQMYLAHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWR
TE
GenBank ID Protein 55958253
UniProtKB/Swiss-Prot ID Q9H4F1
UniProtKB/Swiss-Prot Entry Name Q5T9D0_HUMAN
PDB IDs Not Available
GenBank Gene ID AL157935
GeneCard ID Q5T9D0
GenAtlas ID ST6GALNAC4
HGNC ID HGNC:17846
References
General References Not Available