You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09374
Secondary Accession Numbers
  • 15238
Name Hyaluronidase-2
Synonyms
  1. Hyal-2
  2. Hyaluronoglucosaminidase-2
  3. LuCa-2
  4. Lung carcinoma protein 2
Gene Name HYAL2
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Hydrolyzes high molecular weight hyaluronic acid to produce an intermediate-sized product which is further hydrolyzed by sperm hyaluronidase to give small oligosaccharides. Displays very low levels of activity. Associates with and negatively regulates MST1R.
Pathways
  • Glycosaminoglycan degradation
Reactions
+ Water → DWA-2 + N-Acetylgalactosamine details
+ Water → DWA-2 + N-Acetylgalactosamine 4-sulphate details
GO Classification
Biological Process
small molecule metabolic process
positive regulation of apoptotic process
negative regulation of MAP kinase activity
cellular response to UV-B
cellular response to fibroblast growth factor stimulus
monocyte activation
negative regulation of protein kinase B signaling cascade
positive regulation of inflammatory response
positive regulation of interleukin-6 secretion
positive regulation of interleukin-8 secretion
positive regulation of protein import into nucleus
transformation of host cell by virus
viral entry into host cell via membrane fusion with the plasma membrane
response to reactive oxygen species
cellular response to tumor necrosis factor
hyaluronan catabolic process
cellular response to interleukin-1
negative regulation of fibroblast migration
renal water absorption
defense response to virus
positive regulation of transcription from RNA polymerase II promoter
negative regulation of cell growth
positive regulation of urine volume
cartilage development
response to antibiotic
kidney development
cellular response to transforming growth factor beta stimulus
carbohydrate metabolic process
Cellular Component
cytosol
membrane raft
endoplasmic reticulum
endocytic vesicle
perinuclear region of cytoplasm
lysosome
microvillus
anchored to external side of plasma membrane
apical plasma membrane
Golgi membrane
Function
hyalurononglucosaminidase activity
hexosaminidase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing o-glycosyl compounds
Molecular Function
viral receptor activity
hyalurononglucosaminidase activity
hyaluronic acid binding
hyaluronoglucuronidase activity
receptor signaling protein tyrosine kinase inhibitor activity
transforming growth factor beta binding
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. GPI-anchor
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs HYAL2
Gene Sequence
>1416 bp
ATGCGGGCAGGCCCAGGCCCCACCGTTACATTGGCCCTGGTGCTGGCGGTGGCATGGGCC
ATGGAGCTCAAGCCCACAGCACCACCCATCTTCACTGGCCGGCCCTTTGTGGTAGCGTGG
GACGTGCCCACACAGGACTGTGGCCCACGCCTCAAGGTGCCACTGGACCTGAATGCCTTT
GATGTGCAGGCCTCACCTAATGAGGGTTTTGTGAACCAGAATATTACCATCTTCTACCGC
GACCGTCTAGGCCTGTATCCACGCTTCGATTCTGCCGGAAGGTCTGTGCATGGTGGTGTG
CCACAGAATGTCAGCCTTTGGGCACACCGGAAGATGCTGCAGAAACGTGTGGAGCACTAC
ATTCGGACACAGGAGTCTGCGGGGCTGGCGGTCATCGACTGGGAGGACTGGCGACCTGTG
TGGGTGCGCAACTGGCAGGACAAAGATGTGTATCGCCGGTTATCACGCCAGCTAGTGGCC
AGTCGTCACCCTGACTGGCCTCCAGACCGCATAGTCAAACAGGCACAATATGAGTTTGAG
TTCGCAGCACAGCAGTTCATGCTGGAGACACTGCGTTATGTCAAGGCAGTGCGGCCCCGG
CACCTCTGGGGCTTCTACCTCTTTCCTGACTGCTACAATCATGATTATGTGCAGAACTGG
GAGAGCTACACAGGCCGCTGCCCTGATGTTGAGGTGGCCCGCAATGACCAGCTGGCCTGG
CTGTGGGCTGAGAGCACGGCCCTCTTCCCGTCTGTCTACCTGGACGAGACACTTGCTTCC
GCCCTCCATGGCCGCAACTTTGTGAGCTTCCGTGTTCAGGAGGCCCTTCGTGTGGCTCGC
ACCCACCATGCCAACCATGCACTCCCAGTCTACGTCTTCACACGACCCACCTACAGCCGC
TGCACGGGGCTTAGTGAGATGGACCTCATCTCTACCATTGGCGAGAGTGCGGCCCTGGGC
GCAGCTGGTGTCATCCTCTGGGGTGACGCGGGGTACACCACAAGCACGGAGACCTGCCAG
TACCTCAAAGATTACCTGACACGGCTGCTGGTCCCCTACGTGGTCAATGTGTCCTGGGCC
ACCCAATATTGCAGCCGGGCCCAGTGCCATGGCCATGGCTGTGTGCCCGGCAACCCCAGT
GCCAGTACCTTCCTGCATCTCAGCACCAACAGTTTCCGCCTAGTGCCTGGCCATGCACCT
GGTGAACCCCAGCTGCGACCTGTGGGGGAGCTCAGTTGGGCCGACATTGACCACCTGCAG
ACACACTTCCGCTGCCAGTGCTACTTGGGCTGGAGTGGTGAGCAATGCCAGTGGGACCAT
AGGCAGGCAGCTGGAGGTGCCAACGAGGCCTGGGCTGGGTCCCACCTCACCAGTCTGCTG
GCTCTGGCAGCCCTGGCCTTTACCTGGACCTTGTAG
Protein Properties
Number of Residues 473
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Hyaluronidase-2
MRAGPGPTVTLALVLAVAWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAF
DVQASPNEGFVNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHY
IRTQESAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASRHPDWPPDRIVKQAQYEFE
FAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQLAW
LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR
RLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRLLVPYVVNVSW
ATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDH
LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL
GenBank ID Protein 4378959
UniProtKB/Swiss-Prot ID Q12891
UniProtKB/Swiss-Prot Entry Name HYAL2_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ000099
GeneCard ID HYAL2
GenAtlas ID HYAL2
HGNC ID HGNC:5321
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  3. Danilkovitch-Miagkova A, Duh FM, Kuzmin I, Angeloni D, Liu SL, Miller AD, Lerman MI: Hyaluronidase 2 negatively regulates RON receptor tyrosine kinase and mediates transformation of epithelial cells by jaagsiekte sheep retrovirus. Proc Natl Acad Sci U S A. 2003 Apr 15;100(8):4580-5. Epub 2003 Apr 3. [PubMed:12676986 ]
  4. Lepperdinger G, Strobl B, Kreil G: HYAL2, a human gene expressed in many cells, encodes a lysosomal hyaluronidase with a novel type of specificity. J Biol Chem. 1998 Aug 28;273(35):22466-70. [PubMed:9712871 ]
  5. Lepperdinger G, Mullegger J, Kreil G: Hyal2--less active, but more versatile? Matrix Biol. 2001 Dec;20(8):509-14. [PubMed:11731268 ]
  6. Rai SK, Duh FM, Vigdorovich V, Danilkovitch-Miagkova A, Lerman MI, Miller AD: Candidate tumor suppressor HYAL2 is a glycosylphosphatidylinositol (GPI)-anchored cell-surface receptor for jaagsiekte sheep retrovirus, the envelope protein of which mediates oncogenic transformation. Proc Natl Acad Sci U S A. 2001 Apr 10;98(8):4443-8. [PubMed:11296287 ]