You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09425
Secondary Accession Numbers
  • 15303
Name Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
Synonyms
  1. PP2A subunit B isoform PR48
  2. Protein phosphatase 2A 48 kDa regulatory subunit
Gene Name PPP2R3B
Protein Type Enzyme
Biological Properties
General Function Involved in calcium ion binding
Specific Function The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs PPP2R3B
Gene Sequence
>1728 bp
ATGCCGCCCGGCAAAGTGCTGCAGCCGGTCCTGAAGATGAAGGTGGACGAGCTGTTCCTG
TACTGGCTCAGCGAGGCCAGCACGCAGCGGATGCTGCAGGACTGCCTGCGCCGGATCAAG
GCGCCCGGGCGGGACCAGCCGACCCCGGGGGACGGGGAGCAGCCCGGGGCCTGGCCCACA
GCCCCGCTCGCCGCCCCCCGGCCCAGCGGGCTCGAACCCCCGGGAACCCCCGGGCCGGGC
CCTGCGCTGCCCCTGGGCGCCGCCTCCAGCCCCAGGAACGCGCCCCACGTTCGAGGCACC
CGTAGATCCGCAGGGACGAGAGTAGTTCAGACACGGAAAGAAGAGCCTCTGCCCCCGGCC
ACGAGCCAAAGCATTCCGACCTTCTACTTCCCCAGAGGACGCCCGCAGGACTCCGTCAAC
GTGGATGCCGTCATCAGCAAGATCGAGAGCACCTTCGCCCGGTTCCCCCACGAGAGGGCC
ACCATGGATGACATGGGCCTGGTGGCCAAGGCCTGCGGCTGCCCCCTCTACTGGAAGGGG
CCGCTCTTCTATGGCGCCGGCGGGGAGCGCACGGGCTCCGTGTCCGTCCACAAGTTCGTC
GCCATGTGGAGAAAAATCCTCCAGAACTGCCACGACGACGCGGCCAAGTTCGTCCATCTG
CTCATGAGCCCCGGCTGCAACTACCTGGTGCAGGAGGACTTTGTCCCCTTCTTGCAGGAC
GTGGTGAACACGCACCCGGGGCTGTCGTTCCTGAAGGAGGCGTCCGAGTTCCACTCGCGC
TACATCACCACGGTCATCCAGCGGATCTTCTACGCCGTGAACCGGTCCTGGTCCGGCAGG
ATCACCTGCGCCGAGCTGCGGAGGAGCTCCTTCCTGCAGAATGTGGCGCTGCTGGAGGAG
GAGGCGGACATCAACCAGCTGACCGAATTCTTCTCGTACGAGCATTTCTACGTCATCTAC
TGCAAGTTCTGGGAGCTGGACACGGACCACGACCTGCTCATCGACGCGGACGACCTGGCG
CGGCACAATGACCACGCCCTTTCTACCAAGATGATAGACAGGATCTTCTCAGGAGCAGTC
ACACGAGGCAGAAAAGTGCAGAAGGAAGGGAAGATCAGCTATGCCGACTTTGTCTGGTTT
TTGATCTCTGAGGAAGACAAAAAAACACCGACCAGCATCGAGTACTGGTTCCGCTGCATG
GACCTGGACGGGGACGGCGCCCTGTCCATGTTCGAGCTCGAGTACTTCTACGAGGAGCAG
TGCCGAAGGCTGGACAGCATGGCCATCGAGGCCCTGCCCTTCCAGGACTGCCTCTGCCAG
ATGCTGGACCTGGTCAAGCCGAGGACTGAAGGGAAGATCACGCTGCAGGACCTGAAGCGC
TGCAAGCTGGCTAACGTCTTCTTCGACACCTTCTTCAACATCGAGAAGTACCTCGACCAC
GAGCAGAAAGAGCAGATCTCCCTGCTCAGGGACGGTGACAGCGGCGGCCCCGAGCTCTCG
GACTGGGAGAAGTACGCGGCCGAGGAGTACGACATCCTGGTGGCCGAGGAGACTGCGGGA
GAGCCCTGGGAGGACGGGTTCGAGGCCGAGCTCAGCCCTGTGGAGCAGAAGCTGAGTGCG
CTGCGCTCCCCGCTGGCCCAGAGGCCCTTCTTCGAGGCGCCCTCACCGCTGGGCGCCGTG
GACCTGTACGAGTACGCATGCGGGGACGAGGACCTGGAGCCGCTGTGA
Protein Properties
Number of Residues 575
Molecular Weight 65060.1
Theoretical pI 4.77
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
MPPGKVLQPVLKMKVDELFLYWLSEASTQRMLQDCLRRIKAPGRDQPTPGDGEQPGAWPT
APLAAPRPSGLEPPGTPGPGPALPLGAASSPRNAPHVRGTRRSAGTRVVQTRKEEPLPPA
TSQSIPTFYFPRGRPQDSVNVDAVISKIESTFARFPHERATMDDMGLVAKACGCPLYWKG
PLFYGAGGERTGSVSVHKFVAMWRKILQNCHDDAAKFVHLLMSPGCNYLVQEDFVPFLQD
VVNTHPGLSFLKEASEFHSRYITTVIQRIFYAVNRSWSGRITCAELRRSSFLQNVALLEE
EADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDADDLARHNDHALSTKMIDRIFSGAV
TRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQ
CRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDH
EQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSA
LRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL
GenBank ID Protein 33695078
UniProtKB/Swiss-Prot ID Q9Y5P8
UniProtKB/Swiss-Prot Entry Name P2R3B_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_013239.4
GeneCard ID PPP2R3B
GenAtlas ID PPP2R3B
HGNC ID HGNC:13417
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  4. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  5. Yan Z, Fedorov SA, Mumby MC, Williams RS: PR48, a novel regulatory subunit of protein phosphatase 2A, interacts with Cdc6 and modulates DNA replication in human cells. Mol Cell Biol. 2000 Feb;20(3):1021-9. [PubMed:10629059 ]
  6. Stevens I, Janssens V, Martens E, Dilworth S, Goris J, Van Hoof C: Identification and characterization of B"-subunits of protein phosphatase 2 A in Xenopus laevis oocytes and adult tissues. Eur J Biochem. 2003 Jan;270(2):376-87. [PubMed:12605688 ]