Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09432
Secondary Accession Numbers
  • 15311
Name Glutamyl aminopeptidase
Synonyms
  1. AP-A
  2. Aminopeptidase A
  3. CD249 antigen
  4. Differentiation antigen gp160
  5. EAP
Gene Name ENPEP
Protein Type Enzyme
Biological Properties
General Function Involved in proteolysis
Specific Function Appears to have a role in the catabolic pathway of the renin-angiotensin system. Probably plays a role in regulating growth and differentiation of early B-lineage cells
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
peptidase activity
peptidase activity, acting on l-amino acid peptides
metallopeptidase activity
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location Chromosome:4
Locus 4q25
SNPs ENPEP
Gene Sequence
>2874 bp
ATGAACTTTGCGGAGAGAGAGGGCTCTAAGAGATACTGCATTCAAACGAAACATGTGGCC
ATTCTCTGTGCGGTGGTGGTGGGTGTAGGATTAATAGTGGGACTTGCCGTGGGCTTGACC
AGATCGTGTGACTCCAGCGGGGACGGCGGGCCGGGCACTGCGCCAGCTCCTTCCCACCTG
CCTTCTTCCACGGCCAGCCCCTCAGGTCCTCCTGCCCAGGACCAGGACATCTGCCCGGCC
AGTGAGGATGAGAGCGGACAGTGGAAAAACTTTCGACTGCCGGACTTCGTCAACCCAGTC
CACTACGACCTGCACGTGAAGCCCCTGTTGGAGGAGGACACCTACACGGGCACCGTGAGC
ATCTCCATCAACCTGAGCGCTCCCACCCGGTACCTGTGGCTGCACCTCCGGGAGACCAGG
ATCACCCGGCTCCCGGAGCTGAAGAGGCCCTCTGGGGACCAGGTGCAAGTCCGGAGGTGT
TTCGAGTACAAAAAGCAGGAGTACGTGGTGGTCGAGGCGGAGGAAGAGCTTACCCCCAGC
AGTGGAGATGGCCTGTATCTCCTGACCATGGAGTTCGCCGGCTGGCTGAACGGCTCCCTC
GTGGGATTTTATAGAACCACCTACACGGAGAACGGACAAGTCAAGAGCATAGTGGCCACC
GATCATGAACCAACAGATGCCAGGAAATCTTTTCCTTGTTTTGATGAGCCCAACAAAAAG
GCAACTTATACAATATCTATCACCCATCCCAAAGAATACGGAGCACTTTCAAATATGCCA
GTGGCGAAAGAAGAGTCAGTGGATGATAAATGGACTCGAACAACTTTTGAGAAGTCTGTC
CCCATGAGCACGTACCTGGTGTGCTTTGCTGTACATCAATTTGACTCTGTAAAGAGAATA
TCAAATAGTGGAAAACCTCTTACAATTTATGTCCAGCCAGAGCAAAAGCACACAGCCGAA
TATGCTGCAAACATAACTAAAAGTGTGTTTGATTATTTTGAAGAATACTTTGCTATGAAT
TATTCTCTTCCTAAATTAGATAAAATCGCTATTCCAGATTTTGGCACTGGTGCCATGGAG
AACTGGGGACTCATCACGTACAGAGAAACGAACCTGCTTTATGACCCTAAGGAATCAGCC
TCATCAAACCAACAGAGGGTGGCCACTGTGGTTGCCCATGAACTTGTGCATCAGTGGTTT
GGAAATATTGTGACCATGGACTGGTGGGAAGACTTGTGGCTAAATGAAGGATTTGCTTCT
TTCTTTGAGTTTCTGGGAGTAAACCATGCAGAAACAGACTGGCAAATGCGTGACCAAATG
TTACTTGAAGATGTATTACCTGTTCAAGAGGATGATTCTTTGATGTCTTCGCATCCAATT
ATTGTGACTGTGACAACCCCTGATGAAATAACATCTGTTTTTGATGGAATATCCTATAGC
AAGGGATCTTCTATTTTGAGAATGCTTGAAGACTGGATAAAACCAGAGAATTTTCAAAAA
GGATGTCAGATGTACTTGGAAAAATACCAATTCAAGAATGCAAAAACTTCTGATTTTTGG
GCAGCACTGGAAGAGGCAAGTAGGCTACCAGTGAAAGAAGTAATGGACACCTGGACCAGA
CAGATGGGTTATCCTGTGCTTAACGTGAACGGTGTCAAGAACATCACACAGAAACGCTTT
TTGTTGGACCCAAGAGCTAACCCTTCTCAGCCCCCTTCAGATCTTGGTTATACATGGAAT
ATCCCAGTTAAATGGACTGAAGATAATATAACAAGCAGTGTGTTATTTAATAGGTCAGAA
AAAGAAGGAATCACTTTGAACTCCTCTAATCCTAGTGGAAATGCTTTTCTCAAAATAAAC
CCAGATCATATTGGGTTTTATCGTGTAAATTATGAAGTAGCAACTTGGGACTCGATAGCT
ACAGCGCTCTCCTTGAACCACAAGACATTTTCTTCAGCAGATCGTGCAAGTCTTATTGAT
GATGCTTTTGCCTTGGCAAGAGCTCAACTTCTAGATTATAAGGTGGCTTTGAACTTGACC
AAGTATCTCAAAAGGGAAGAGAATTTTTTACCATGGCAGAGAGTAATTTCAGCTGTAACC
TACATCATTAGCATGTTTGAAGATGATAAAGAGCTATATCCTATGATTGAGGAATACTTC
CAAGGTCAAGTGAAGCCTATTGCAGATTCTCTGGGATGGAATGATGCTGGAGACCATGTC
ACAAAGTTACTCCGTTCCTCCGTGTTAGGGTTTGCGTGCAAGATGGGAGACAGAGAAGCC
TTGAACAATGCTTCCTCGTTATTTGAGCAGTGGCTAAATGGGACTGTAAGCCTTCCCGTA
AATCTCAGGCTTCTGGTGTATCGGTATGGGATGCAGAACTCTGGCAATGAGATTTCATGG
AACTACACTCTTGAGCAATACCAGAAAACTTCATTAGCTCAAGAAAAAGAAAAACTGCTG
TATGGATTAGCATCAGTGAAGAACGTTACTCTTTTGTCAAGGTATTTGGATTTGCTCAAG
GACACGAACCTTATTAAAACTCAGGATGTGTTTACAGTCATTCGATATATCTCATATAAC
AGCTATGGGAAGAACATGGCCTGGAATTGGATACAACTCAACTGGGACTATCTAGTCAAC
AGATATACACTCAATAACAGAAACCTTGGCCGAATTGTCACAATAGCAGAGCCATTCAAC
ACTGAACTGCAACTGTGGCAGATGGAGAGCTTTTTTGCAAAATATCCACAAGCTGGAGCA
GGAGAAAAACCTAGGGAACAAGTGCTGGAAACAGTGAAAAACAATATAGAGTGGCTAAAA
CAACATAGAAACACCATCAGAGAATGGTTTTTTAATTTACTTGAGAGTGGTTAA
Protein Properties
Number of Residues 957
Molecular Weight 109243.6
Theoretical pI 5.13
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 19-39
Protein Sequence
>Glutamyl aminopeptidase
MNFAEREGSKRYCIQTKHVAILCAVVVGVGLIVGLAVGLTRSCDSSGDGGPGTAPAPSHL
PSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVS
ISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPS
SGDGLYLLTMEFAGWLNGSLVGFYRTTYTENGQVKSIVATDHEPTDARKSFPCFDEPNKK
ATYTISITHPKEYGALSNMPVAKEESVDDKWTRTTFEKSVPMSTYLVCFAVHQFDSVKRI
SNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIAIPDFGTGAME
NWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFAS
FFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYS
KGSSILRMLEDWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEEASRLPVKEVMDTWTR
QMGYPVLNVNGVKNITQKRFLLDPRANPSQPPSDLGYTWNIPVKWTEDNITSSVLFNRSE
KEGITLNSSNPSGNAFLKINPDHIGFYRVNYEVATWDSIATALSLNHKTFSSADRASLID
DAFALARAQLLDYKVALNLTKYLKREENFLPWQRVISAVTYIISMFEDDKELYPMIEEYF
QGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPV
NLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLK
DTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFN
TELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWFFNLLESG
GenBank ID Protein 132814467
UniProtKB/Swiss-Prot ID Q07075
UniProtKB/Swiss-Prot Entry Name AMPE_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001977.3
GeneCard ID ENPEP
GenAtlas ID ENPEP
HGNC ID HGNC:3355
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  5. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  6. Nanus DM, Engelstein D, Gastl GA, Gluck L, Vidal MJ, Morrison M, Finstad CL, Bander NH, Albino AP: Molecular cloning of the human kidney differentiation antigen gp160: human aminopeptidase A. Proc Natl Acad Sci U S A. 1993 Aug 1;90(15):7069-73. [PubMed:8346219 ]
  7. Li L, Wang J, Cooper MD: cDNA cloning and expression of human glutamyl aminopeptidase (aminopeptidase A). Genomics. 1993 Sep;17(3):657-64. [PubMed:8244382 ]