You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09443
Secondary Accession Numbers
  • 15324
Name Putative uncharacterized protein IP6K1
Synonyms
  1. SubName: cDNA FLJ57373, highly similar to Inositol hexaphosphate kinase 1 (EC 2.7.4.21)
Gene Name IP6K1
Protein Type Enzyme
Biological Properties
General Function Involved in inositol trisphosphate 3-kinase activity
Specific Function Not Available
Pathways
  • Inositol Phosphate Metabolism
Reactions Not Available
GO Classification
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
inositol or phosphatidylinositol kinase activity
inositol trisphosphate kinase activity
inositol trisphosphate 3-kinase activity
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:3
Locus 3p21.31
SNPs IP6K1
Gene Sequence
>831 bp
ATGCTAGATGGCAACAGTGGCTTGAGTTCTGAGAAGATCAGCCACAACCCCTGGAGCCTG
CGTTGTCACAAGCAGCAGCTGAGCCGCATGCGCTCCGAGTCCAAGGACCGAAAGCTCTAC
AAGTTCCTCCTGCTTGAGAACGTGGTGCACCACTTCAAGTACCCCTGCGTGTTGGACCTG
AAGATGGGCACGCGGCAGCATGGCGATGACGCGTCAGCTGAGAAGGCAGCCCGGCAGATG
CGGAAATGCGAGCAGAGCACATCAGCCACGCTGGGCGTCAGGGTCTGCGGCATGCAGGTG
TACCAGCTGGACACAGGGCATTACCTCTGCAGGAACAAGTACTATGGCCGTGGGCTCTCC
ATTGAAGGCTTCCGCAATGCCCTCTATCAATATCTGCACAATGGCCTGGACCTGCGACGT
GACCTGTTTGAGCCTATCCTGAGCAAACTGCGGGGCCTGAAAGCTGTGCTGGAGCGGCAG
GCCTCTTACCGCTTCTACTCCAGTTCCCTGCTTGTCATCTATGATGGCAAGGAGTGCCGG
GCTGAGTCCTGCCTGGACCGCCGGTCTGAGATGCGTCTCAAGCACCTGGACATGGTGCTC
CCTGAGGTGGCGTCATCCTGTGGCCCCAGCACCAGCCCCAGCAACACCAGCCCCGAGGCG
GGTCCCTCCTCTCAGCCCAAGGTGGATGTCCGCATGATTGACTTTGCACACAGCACATTC
AAGGGCTTCCGGGATGACCCCACCGTGCATGATGGGCCAGACAGAGGCTACGTGTTTGGC
CTGGAGAACCTCATCAGCATCATGGAACAGATGCGGGACGAGAACCAGTAG
Protein Properties
Number of Residues 276
Molecular Weight 31523.6
Theoretical pI 8.7
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Putative uncharacterized protein IP6K1
MLDGNSGLSSEKISHNPWSLRCHKQQLSRMRSESKDRKLYKFLLLENVVHHFKYPCVLDL
KMGTRQHGDDASAEKAARQMRKCEQSTSATLGVRVCGMQVYQLDTGHYLCRNKYYGRGLS
IEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYDGKECR
AESCLDRRSEMRLKHLDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVRMIDFAHSTF
KGFRDDPTVHDGPDRGYVFGLENLISIMEQMRDENQ
GenBank ID Protein 55769518
UniProtKB/Swiss-Prot ID Q92551
UniProtKB/Swiss-Prot Entry Name A8MUX4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001006115.2
GeneCard ID IP6K1
GenAtlas ID IP6K1
HGNC ID HGNC:18360
References
General References
  1. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]