Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09444
Secondary Accession Numbers
  • 15325
Name EPH receptor A8
Synonyms Not Available
Gene Name EPHA8
Protein Type Enzyme
Biological Properties
General Function Involved in ephrin receptor activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
integral to plasma membrane
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
protein tyrosine kinase activity
transmembrane receptor protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
ephrin receptor activity
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
enzyme linked receptor protein signaling pathway
transmembrane receptor protein tyrosine kinase signaling pathway
metabolic process
cellular metabolic process
protein amino acid phosphorylation
signaling
signaling pathway
cell surface receptor linked signaling pathway
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 1p36.12
SNPs EPHA8
Gene Sequence
>1488 bp
ATGGCCCCCGCCCGGGGCCGCCTGCCCCCTGCGCTCTGGGTCGTCACGGCCGCGGCGGCG
GCGGCCACCTGCGTGTCCGCGGCGCGCGGCGAAGTGAATTTGCTGGACACGTCGACCATC
CACGGGGACTGGGGCTGGCTCACGTATCCGGCTCATGGGTGGGACTCCATCAACGAGGTG
GACGAGTCCTTCCAGCCCATCCACACGTACCAGGTTTGCAACGTCATGAGCCCCAACCAG
AACAACTGGCTGCGCACGAGCTGGGTCCCCCGAGACGGCGCCCGGCGCGTCTATGCTGAG
ATCAAGTTTACCCTGCGCGACTGCAACAGCATGCCTGGTGTGCTGGGCACCTGCAAGGAG
ACCTTCAACCTCTACTACCTGGAGTCGGACCGCGACCTGGGGGCCAGCACACAAGAAAGC
CAGTTCCTCAAAATCGACACCATTGCGGCCGACGAGAGCTTCACAGGTGCCGACCTTGGT
GTGCGGCGTCTCAAGCTCAACACGGAGGTGCGCAGTGTGGGTCCCCTCAGCAAGCGCGGC
TTCTACCTGGCCTTCCAGGACATAGGTGCCTGCCTGGCCATCCTCTCTCTCCGCATCTAC
TATAAGAAGTGCCCTGCCATGGTGCGCAATCTGGCTGCCTTCTCGGAGGCAGTGACGGGG
GCCGACTCGTCCTCACTGGTGGAGGTGAGGGGCCAGTGCGTGCGGCACTCAGAGGAGCGG
GACACACCCAAGATGTACTGCAGCGCGGAGGGCGAGTGGCTCGTGCCCATCGGCAAATGC
GTGTGCAGTGCCGGCTACGAGGAGCGGCGGGATGCCTGTGTGGCCTGTGAGCTGGGCTTC
TACAAGTCAGCCCCTGGGGACCAGCTGTGTGCCCGCTGCCCTCCCCACAGCCACTCCGCA
GCTCCAGCCGCCCAAGCCTGCCACTGTGACCTCAGCTACTACCGTGCAGCCCTGGACCCG
CCGTCCTCAGCCTGCACCCGGCCACCCTCGGCACCAGTGAACCTGATCTCCAGTGTGAAT
GGGACATCAGTGACTCTGGAGTGGGCCCCTCCCCTGGACCCAGGTGGCCGCAGTGACATC
ACCTACAATGCCGTGTGCCGCCGCTGCCCCTGGGCACTGAGCCGCTGCGAGGCATGTGGG
AGCGGCACCCGCTTTGTGCCCCAGCAGACAAGCCTGGTGCAGGCCAGCCTGCTGGTGGCC
AACCTGCTGGCCCACATGAACTACTCCTTCTGGATCGAGGCCGTCAATGGCGTGTCCGAC
CTGAGCCCCGAGCCCCGCCGGGCCGCTGTGGTCAACATCACCACGAACCAGGCAGGTAGG
CGGAGAAACTCCGTCCCGCAGCGTCCTGGTCCCCCAGCTTCCCCTGCCTCAGACCCATCC
AGGGATCAGAGCTCTGCCGGGGACGTGCTGTGGGCCTTTAGGCAAGTGCCTCTCTGGCCC
TGCGCTCCTCACCAGGACCCAGAGCTGGAGGCTCTTCATTGCCTTTAG
Protein Properties
Number of Residues 495
Molecular Weight 53899.3
Theoretical pI 6.79
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>EPH receptor A8
MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEV
DESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKE
TFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRG
FYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEER
DTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSA
APAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDI
TYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD
LSPEPRRAAVVNITTNQAGRRRNSVPQRPGPPASPASDPSRDQSSAGDVLWAFRQVPLWP
CAPHQDPELEALHCL
GenBank ID Protein 56417854
UniProtKB/Swiss-Prot ID P29322
UniProtKB/Swiss-Prot Entry Name Q8IUX6_HUMAN
PDB IDs Not Available
GenBank Gene ID AL035703
GeneCard ID EPHA8
GenAtlas ID EPHA8
HGNC ID HGNC:3391
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]