Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09468
Secondary Accession Numbers
  • 15357
Name Cyclin-G-associated kinase
Synonyms Not Available
Gene Name GAK
Protein Type Enzyme
Biological Properties
General Function Involved in heat shock protein binding
Specific Function Associates with cyclin G and CDK5. Seems to act as an auxilin homolog that is involved in the uncoating of clathrin- coated vesicles by Hsc70 in non-neuronal cells. Expression oscillates slightly during the cell cycle, peaking at G1
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
heat shock protein binding
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Cytoplasm
  2. perinuclear region
  3. Golgi apparatus
  4. Cell junction
  5. trans-Golgi network
  6. focal adhesion (Probable)
Gene Properties
Chromosome Location Chromosome:4
Locus 4p16
SNPs GAK
Gene Sequence
>3936 bp
ATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCT
TCCGGCCGCGACCAGAGTGACTTCGTGGGGCAGACGGTGGAACTGGGCGAGCTGCGGCTG
CGGGTGCGGCGGGTCCTGGCCGAAGGAGGGTTTGCATTTGTGTATGAAGCTCAAGATGTG
GGGAGTGGCAGAGAGTATGCATTAAAGAGGCTATTATCCAATGAAGAGGAAAAGAACAGA
GCCATCATTCAAGAAGTTTGCTTCATGAAAAAGCTTTCCGGCCACCCGAACATTGTCCAG
TTTTGTTCTGCAGCGTCTATAGGAAAAGAGGAGTCAGACACGGGGCAGGCTGAGTTCCTC
TTGCTCACAGAGCTCTGTAAAGGGCAGCTGGTGGAATTTTTGAAGAAAATGGAATCTCGA
GGCCCCCTTTCGTGCGACACGGTTCTGAAGATCTTCTACCAGACGTGCCGCGCCGTGCAG
CACATGCACCGGCAGAAGCCGCCCATCATCCACAGGGACCTCAAGGTTGAGAACTTGTTG
CTTAGTAACCAAGGGACCATTAAGCTGTGTGACTTTGGCAGTGCCACGACCATCTCGCAC
TACCCTGACTACAGCTGGAGCGCCCAGAGGCGAGCCCTGGTGGAGGAAGAGATCACGAGG
AATACAACACCAATGTATAGAACACCAGAAATCATAGACTTGTATTCCAACTTCCCGATC
GGCGAGAAGCAGGATATCTGGGCCCTGGGCTGCATCTTGTACCTGCTGTGCTTCCGGCAG
CACCCTTTTGAGGATGGAGCGAAACTTCGAATAGTCAATGGGAAGTACTCGATCCCCCCG
CACGACACGCAGTACACGGTCTTCCACAGCCTCATCCGCGCCATGCTGCAGGTGAACCCG
GAGGAGCGGCTGTCCATCGCCGAGGTGGTGCACCAGCTGCAGGAGATCGCGGCCGCCCGC
AACGTGAACCCCAAGTCTCCCATCACAGAGCTCCTGGAGCAGAATGGAGGCTACGGGAGC
GCCACACTGTCCCGAGGGCCACCCCCTCCCGTGGGCCCCGCTGGCAGTGGCTACAGTGGA
GGCCTGGCGCTGGCGGAGTACGACCAGCCGTATGGCGGCTTCCTGGACATTCTGCGGGGT
GGGACAGAGCGGCTCTTCACCAACCTCAAGGACACCTCCTCCAAGGTCATCCAGTCCGTC
GCTAATTATGCAAAGGGTGACCTGGACATATCTTACATCACATCCAGAATTGCAGTGATG
TCATTCCCAGCAGAAGGTGTGGAGTCAGCGCTCAAAAACAACATCGAAGATGTGCGGTTG
TTCCTGGACTCCAAGCACCCAGGGCACTATGCCGTCTACAACCTGTCCCCGAGGACCTAC
CGGCCCTCCAGGTTCCACAACCGGGTCTCCGAGTGTGGCTGGGCAGCACGGCGGGCCCCA
CACCTGCACACCCTGTACAACATCTGCAGGAACATGCACGCCTGGCTGCGGCAGGACCAC
AAGAACGTCTGCGTCGTGCACTGCATGGACGGGAGAGCCGCGTCTGCTGTGGCCGTCTGC
TCCTTCCTGTGCTTCTGCCGTCTCTTCAGCACCGCGGAGGCCGCCGTGTACATGTTCAGC
ATGAAGCGCTGCCCACCAGGCATCTGGCCATCCCACAAAAGGTACATCGAGTACATGTGT
GACATGGTGGCGGAGGAGCCCATCACACCCCACAGCAAGCCCATCCTGGTGAGGGCCGTG
GTCATGACACCCGTGCCGCTGTTCAGCAAGCAGAGGAGCGGCTGCAGGCCCTTCTGCGAG
GTCTACGTGGGGGACGAGCGTGTGGCCAGCACCTCCCAGGAGTACGACAAGATGCGGGAC
TTTAAGATTGAAGATGGCAAAGCGGTGATTCCCCTGGGCGTCACGGTGCAAGGAGACGTG
CTCATCGTCATCTATCACGCCCGGTCCACTCTGGGCGGCCGGCTGCAGGCCAAGATGGCA
TCCATGAAGATGTTCCAGATTCAGTTCCACACGGGGTTTGTGCCTCGGAACGCCACCACT
GTGAAATTTGCCAAGTATGACCTGGACGCGTGTGACATTCAAGAAAAATACCCGGATTTA
TTTCAAGTGAACCTGGAAGTGGAGGTGGAGCCCAGGGACAGGCCGAGCCGGGAAGCCCCA
CCATGGGAGAACTCGAGCATGAGGGGGCTGAACCCCAAAATCCTGTTTTCCAGCCGGGAG
GAGCAGCAAGACATTCTGTCTAAGTTTGGGAAGCCGGAGCTTCCCCGGCAGCCTGGCTCC
ACGGCTCAGTATGATGCTGGGGCAGGGTCCCCGGAAGCCGAACCCACAGACTCTGACTCA
CCGCCAAGCAGCAGCGCGGACGCCAGTCGCTTCCTGCACACGCTGGACTGGCAGGAAGAG
AAGGAGGCAGAGACTGGTGCAGAAAATGCCTCTTCCAAGGAGAGCGAGTCTGCCCTGATG
GAGGACAGAGACGAGAGTGAGGTGTCAGATGAAGGGGGATCCCCGATCTCCAGCGAGGGC
CAGGAACCCAGGGCCGACCCAGAGCCCCCCGGCCTGGCAGCAGGGCTGGTGCAGCAGGAC
TTGGTTTTTGAGGTGGAGACACCGGCTGTGCTGCCAGAGCCTGTGCCACAGGAAGACGGG
GTCGACCTCCTGGGCCTGCACTCCGAGGTGGGCGCAGGGCCAGCTGTACCCCCGCAGGCC
TGCAAGGCCCCCTCCAGCAACACCGACCTGCTCAGCTGCCTCCTTGGGCCCCCTGAGGCC
GCCTCCCAGGGGCCCCCGGAGGATCTGCTCAGCGAGGACCCGCTGCTCCTGGCAAGCCCG
GCCCCTCCCCTGAGCGTGCAGAGCACCCCAAGAGGAGGGCCCCCTGCCGCTGCTGACCCC
TTTGGCCCGCTTCTGCCGTCTTCAGGCAACAACTCCCAGCCCTGCTCCAATCCTGATCTC
TTCGGCGAATTTCTCAATTCGGACTCTGTGACCGTCCCACCATCCTTCCCGTCTGCCCAC
AGTGCTCCGCCCCCATCCTGCAGCGCCGACTTCCTGCACCTGGGGGATCTGCCAGGAGAG
CCCAGCAAGATGACAGCCTCGTCCAGCAACCCAGACCTGCTGGGAGGATGGGCTGCCTGG
ACCGAGACTGCAGCATCGGCAGTGGCCCCCACGCCAGCCACAGAAGGCCCCCTCTTCTCT
CCTGGAGGTCAGCCGGCCCCTTGTGGCTCTCAGGCCAGCTGGACCAAGTCTCAGAACCCG
GACCCATTTGCTGACCTTGGCGACCTCAGCTCCGGCCTCCAAGGCTCACCAGCTGGATTC
CCTCCTGGGGGCTTCATTCCCAAAACGGCCACCACGCCCAAAGGCAGCAGCTCCTGGCAG
ACAAGTCGGCCGCCAGCCCAGGGCGCCTCATGGCCCCCTCAGGCCAAGCCGCCCCCCAAA
GCCTGCACACAGCCAAGGCCTAACTATGCCTCGAACTTCAGTGTGATCGGGGCGCGGGAG
GAGCGGGGGGTCCGCGCACCCAGCTTTGCTCAAAAGCCAAAAGTCTCTGAGAACGACTTT
GAAGATCTGTTGTCCAATCAAGGCTTCTCCTCCAGGTCTGACAAGAAAGGGCCAAAGACC
ATTGCAGAGATGAGGAAGCAGGACCTGGCTAAAGACACGGACCCACTCAAGCTGAAGCTC
CTGGACTGGATTGAGGGCAAGGAGCGGAACATCCGGGCCCTGCTGTCCACGCTGCACACA
GTGCTGTGGGACGGGGAGAGCCGCTGGACGCCCGTGGGCATGGCCGACCTGGTGGCTCCG
GAGCAAGTGAAGAAGCACTATCGCCGCGCGGTGCTGGCTGTGCACCCCGACAAGGCTGCG
GGGCAGCCGTACGAGCAGCACGCCAAGATGATCTTCATGGAGCTGAATGACGCCTGGTCG
GAGTTTGAGAACCAGGGCTCCCGGCCCCTCTTCTGA
Protein Properties
Number of Residues 1311
Molecular Weight 143189.2
Theoretical pI 5.47
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cyclin-G-associated kinase
MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDV
GSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFL
LLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLL
LSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPI
GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNP
EERLSIAEVVHQLQEIAAARNVNPKSPITELLEQNGGYGSATLSRGPPPPVGPAGSGYSG
GLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVM
SFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAP
HLHTLYNICRNMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFS
MKRCPPGIWPSHKRYIEYMCDMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCE
VYVGDERVASTSQEYDKMRDFKIEDGKAVIPLGVTVQGDVLIVIYHARSTLGGRLQAKMA
SMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAP
PWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGSPEAEPTDSDS
PPSSSADASRFLHTLDWQEEKEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEG
QEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDGVDLLGLHSEVGAGPAVPPQA
CKAPSSNTDLLSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADP
FGPLLPSSGNNSQPCSNPDLFGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGE
PSKMTASSSNPDLLGGWAAWTETAASAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNP
DPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPK
ACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFSSRSDKKGPKT
IAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAP
EQVKKHYRRAVLAVHPDKAAGQPYEQHAKMIFMELNDAWSEFENQGSRPLF
GenBank ID Protein 157384971
UniProtKB/Swiss-Prot ID O14976
UniProtKB/Swiss-Prot Entry Name GAK_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005255.2
GeneCard ID GAK
GenAtlas ID GAK
HGNC ID HGNC:4113
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  7. Kimura SH, Tsuruga H, Yabuta N, Endo Y, Nojima H: Structure, expression, and chromosomal localization of human GAK. Genomics. 1997 Sep 1;44(2):179-87. [PubMed:9299234 ]
  8. Greener T, Zhao X, Nojima H, Eisenberg E, Greene LE: Role of cyclin G-associated kinase in uncoating clathrin-coated vesicles from non-neuronal cells. J Biol Chem. 2000 Jan 14;275(2):1365-70. [PubMed:10625686 ]