Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09475
Secondary Accession Numbers
  • 15364
Name LIM domain kinase 2
Synonyms
  1. SubName: LIM domain kinase 2, isoform CRA_b
Gene Name LIMK2
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of phosphorus metabolic process
regulation of phosphate metabolic process
regulation of phosphorylation
cellular metabolic process
protein amino acid phosphorylation
regulation of cellular metabolic process
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 22q12.2
SNPs LIMK2
Gene Sequence
>2061 bp
ATGGGGAGTTACTTGTCAGTCCCGGCTTACTTCACCTCCAGAGACCTGTTTCGGTGTTCA
GAATGCCAGGATTCCCTCACCAACTGGTACTATGAGAAGGATGGGAAGCTCTACTGCCCC
AAGGACTACTGGGGGAAGTTTGGGGAGTTCTGTCATGGGTGCTCCCTGCTGATGACAGGG
CCTTTTATGGTGGCTGGGGAGTTCAAGTACCACCCAGAGTGCTTTGCCTGTATGAGCTGC
AAGGTGATCATTGAGGATGGGGATGCATATGCACTGGTGCAGCATGCCACCCTCTACTGT
GGGAAGTGCCACAATGAGGTGGTGCTGGCACCCATGTTTGAGAGACTCTCCACAGAGTCT
GTTCAGGAGCAGCTGCCCTACTCTGTCACGCTCATCTCCATGCCGGCCACCACTGAAGGC
AGGCGGGGCTTCTCCGTGTCCGTGGAGAGTGCCTGCTCCAACTACGCCACCACTGTGCAA
GTGAAAGAGGTCAACCGGATGCACATCAGTCCCAACAATCGAAACGCCATCCACCCTGGG
GACCGCATCCTGGAGATCAATGGGACCCCCGTCCGCACACTTCGAGTGGAGGAGGTGGAG
GATGCAATTAGCCAGACGAGCCAGACACTTCAGCTGTTGATTGAACATGACCCCGTCTCC
CAACGCCTGGACCAGCTGCGGCTGGAGGCCCGGCTCGCTCCTCACATGCAGAATGCCGGA
CACCCCCACGCCCTCAGCACCCTGGACACCAAGGAGAATCTGGAGGGGACACTGAGGAGA
CGTTCCCTAAGGCGCAGTAACAGTATCTCCAAGTCCCCTGGCCCCAGCTCCCCAAAGGAG
CCCCTGCTGTTCAGCCGTGACATCAGCCGCTCAGAATCCCTTCGTTGTTCCAGCAGCTAT
TCACAGCAGATCTTCCGGCCCTGTGACCTAATCCATGGGGAGGTCCTGGGGAAGGGCTTC
TTTGGGCAGGCTATCAAGGTGACACACAAAGCCACGGGCAAAGTGATGGTCATGAAAGAG
TTAATTCGATGTGATGAGGAGACCCAGAAAACTTTTCTGACTGAGGTGAAAGTGATGCGC
AGCCTGGACCACCCCAATGTGCTCAAGTTCATTGGTGTGCTGTACAAGGATAAGAAGCTG
AACCTCCTGACAGAGTACATTGAGGGGGGCACACTGAAGGACTTTCTGCGCAGTATGGAT
CCGTTCCCCTGGCAGCAGAAGGTCAGGTTTGCCAAAGGAATCGCCTCCGGAATGGCCTAT
TTGCACTCTATGTGCATCATCCACCGGGATCTGAACTCGCACAACTGCCTCATCAAGTTG
GACAAGACTGTGGTGGTGGCAGACTTTGGGCTGTCACGGCTCATAGTGGAAGAGAGGAAA
AGGGCCCCCATGGAGAAGGCCACCACCAAGAAACGCACCTTGCGCAAGAACGACCGCAAG
AAGCGCTACACGGTGGTGGGAAACCCCTACTGGATGGCCCCTGAGATGCTGAACGGAAAG
AGCTATGATGAGACGGTGGATATCTTCTCCTTTGGGATCGTTCTCTGTGAGATCATTGGG
CAGGTGTATGCAGATCCTGACTGCCTTCCCCGAACACTGGACTTTGGCCTCAACGTGAAG
CTTTTCTGGGAGAAGTTTGTTCCCACAGATTGTCCCCCGGCCTTCTTCCCGCTGGCCGCC
ATCTGCTGCAGACTGGAGCCTGAGAGCAGAGCCCCCCCCGGGGCCGCAGGAGAGGGCCCG
GGCTGCGCGGATGATGAGGGCCCAGTGAGGCGCCAAGGGAAGGTCACCATCAAGTATGAC
CCCAAGGAGCTACGGAAGCACCTCAACCTAGAGGAGTGGATCCTGGAGCAGCTCACGCGC
CTCTACGACTGCCAGGAAGAGGAGATCTCAGAACTAGAGATTGACGTGGATGAGCTCCTG
GACATGGAGAGTGACGATGCCTGGGCTTCCAGGGTCAAGGAGCTGCTGGTTGACTGTTAC
AAACCCACAGAGGCCTTCATCTCTGGCCTGCTGGACAAGATCCGGGCCATGCAGAAGCTG
AGCACACCCCAGAAGAAGTGA
Protein Properties
Number of Residues 686
Molecular Weight 77884.8
Theoretical pI 7.04
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>LIM domain kinase 2
MGSYLSVPAYFTSRDLFRCSECQDSLTNWYYEKDGKLYCPKDYWGKFGEFCHGCSLLMTG
PFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYCGKCHNEVVLAPMFERLSTES
VQEQLPYSVTLISMPATTEGRRGFSVSVESACSNYATTVQVKEVNRMHISPNNRNAIHPG
DRILEINGTPVRTLRVEEVEDAISQTSQTLQLLIEHDPVSQRLDQLRLEARLAPHMQNAG
HPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPKEPLLFSRDISRSESLRCSSSY
SQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMR
SLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSMDPFPWQQKVRFAKGIASGMAY
LHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKRAPMEKATTKKRTLRKNDRK
KRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVK
LFWEKFVPTDCPPAFFPLAAICCRLEPESRAPPGAAGEGPGCADDEGPVRRQGKVTIKYD
PKELRKHLNLEEWILEQLTRLYDCQEEEISELEIDVDELLDMESDDAWASRVKELLVDCY
KPTEAFISGLLDKIRAMQKLSTPQKK
GenBank ID Protein 15341774
UniProtKB/Swiss-Prot ID P53671
UniProtKB/Swiss-Prot Entry Name Q7L3H5_HUMAN
PDB IDs Not Available
GenBank Gene ID BC013051
GeneCard ID LIMK2
GenAtlas ID LIMK2
HGNC ID HGNC:6614
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231 ]