Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09476
Secondary Accession Numbers
  • 15365
Name Eukaryotic translation initiation factor 2-alpha kinase 4
Synonyms
  1. GCN2-like protein
Gene Name EIF2AK4
Protein Type Enzyme
Biological Properties
General Function Involved in aminoacyl-tRNA ligase activity
Specific Function Can phosphorylate the alpha subunit of EIF2 and may mediate translational control
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
posttranscriptional regulation of gene expression
regulation of translation
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
cellular metabolic process
protein amino acid phosphorylation
regulation of translational initiation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 15q15.1
SNPs EIF2AK4
Gene Sequence
>4950 bp
ATGGCTGGGGGCCGTGGGGCCCCCGGGCGCGGCCGGGACGAGCCTCCGGAGAGCTACCCG
CAACGACAGGACCACGAGCTACAGGCCCTGGAGGCCATCTACGGCGCGGACTTCCAAGAC
CTGCGGCCGGACGCTTGCGGACCGGTCAAAGAGCCCCCTGAAATCAATTTAGTTTTGTAC
CCTCAAGGCCTAACTGGTGAAGAAGTATATGTAAAAGTGGATTTGAGGGTTAAATGCCCA
CCTACCTATCCAGATGTAGTTCCTGAAATAGAGTTAAAAAATGCCAAAGGTCTATCAAAT
GAAAGTGTCAATTTGTTAAAATCTCGCCTAGAAGAACTGGCCAAGAAACACTGTGGGGAG
GTGATGATCTTTGAACTGGCTTACCACGTGCAGTCATTTCTCAGCGAGCATAACAAGCCC
CCTCCCAAGTCTTTTCATGAAGAAATGCTGGAAAGGCGGGCTCAGGAGGAGCAGCAGAGG
CTGTTGGAGGCCAAGCGGAAAGAAGAGCAGGAGCAACGTGAAATCCTGCATGAGATTCAG
AGAAGGAAAGAAGAGATAAAAGAAGAGAAAAAAAGGAAAGAAATGGCTAAGCAGGAACGT
TTGGAAATTGCTAGTTTGTCAAACCAAGATCATACCTCTAAGAAGGACCCAGGAGGACAC
AGAACGGCTGCCATTCTACATGGAGGCTCTCCTGACTTTGTAGGAAATGGTAAACATCGG
GCAAACTCCTCAGGAAGGTCTAGGCGAGAACGTCAGTATTCTGTATGTAATAGTGAAGAT
TCTCCTGGCTCTTGTGAAATTCTGTATTTCAATATGGGGAGTCCTGATCAGCTCATGGTG
CACAAAGGGAAATGTATTGGCAGTGATGAACAACTTGGAAAATTAGTCTACAATGCTTTG
GAAACAGCCACTGGTGGCTTTGTCTTGTTGTATGAGTGGGTCCTTCAGTGGCAGAAAAAA
ATGGGTCCATTCCTTACCAGTCAAGAAAAAGAGAAGATTGATAAGTGCAAAAAGCAGATT
CAAGGAACAGAAACAGAATTCAACTCACTGGTAAAATTGAGCCATCCAAATGTAGTACGC
TACCTTGCAATGAATCTCAAAGAGCAAGACGACTCCATCGTGGTGGACATTTTAGTGGAG
CACATTAGTGGGGTCTCTCTTGCTGCACACCTGAGCCACTCAGGCCCCATCCCTGTGCAT
CAGCTTCGCAGGTACACAGCTCAGCTCCTGTCAGGCCTTGATTATCTGCACAGCAATTCT
GTGGTGCATAAGGTCCTGAGTGCATCTAATGTCTTGGTGGATGCAGAAGGCACCGTCAAG
ATTACGGACTATAGCATTTCTAAGCGCCTCGCAGACATTTGCAAGGAGGATGTGTTTGAG
CAAACCCGAGTTCGTTTTAGTGACAATGCTCTGCCTTATAAAACGGGGAAGAAAGGAGAT
GTTTGGCGTCTTGGCCTTCTGCTGCTGTCCCTCAGCCAAGGACAGGAATGTGGAGAGTAC
CCTGTGACCATCCCTAGTGACTTACCAGCTGACTTTCAAGATTTTCTAAAGAAATGTGTG
TGCTTGGATGACAAGGAAAGATGGAGTCCCCAGCAGTTGTTGAAACACAGCTTTATAAAT
CCCCAGCCAAAAATGCCTCTAGTGGAACAAAGTCCTGAAGATTCTGAAGGACAAGATTAT
GTTGAGACTGTTATTCCTAGCAACCGGCTACCCAGTGCTGCCTTCTTTAGTGAGACACAG
AGACAGTTTTCCCGATACTTCATTGAGTTTGAAGAATTACAACTTCTTGGTAAAGGAGCT
TTTGGAGCTGTCATCAAGGTGCAGAACAAGTTGGACGGCTGCTGCTACGCAGTGAAGCGC
ATCCCCATCAACCCGGCCAGCCGGCAGTTCCGCAGGATCAAGGGCGAAGTGACACTGCTG
TCACGGCTGCACCATGAGAACATTGTGCGCTACTACAACGCCTGGATCGAGCGGCACGAG
CGGCCGGCGGGACCGGGGACGCCGCCCCCGGACTCCGGGCCCCTGGCCAAGGATGACCGA
GCTGCACGCGGGCAGCCGGCGAGCGACACAGACGGCCTGGACAGCGTAGAGGCCGCCGCG
CCGCCACCCATCCTCAGCAGCTCGGTGGAGTGGAGCACTTCGGGCGAGCGCTCGGCCAGT
GCCCGTTTCCCCGCCACCGGCCCGGGCTCCAGCGATGACGAGGACGACGACGAGGACGAG
CACGGTGGCGTCTTCTCCCAGTCCTTCCTGCCTGCTTCAGATTCTGAAAGTGATATTATC
TTTGACAATGAAGATGAGAACAGTAAAAGTCAGAATCAGGATGAAGATTGCAATGAAAAG
AATGGCTGCCATGAAAGTGAGCCATCAGTGACGACTGAGGCTGTGCACTACCTATACATC
CAGATGGAGTACTGTGAGAAGAGCACTTTACGAGACACCATTGACCAGGGACTGTATCGA
GACACCGTCAGACTCTGGAGGCTTTTTCGAGAGATTCTGGATGGATTAGCTTATATCCAT
GAGAAAGGAATGATTCACCGGGATTTGAAGCCTGTCAACATTTTTTTGGATTCTGATGAC
CATGTGAAAATAGGTGATTTTGGTTTGGCGACAGACCATCTAGCCTTTTCTGCTGACAGC
AAACAAGACGATCAGACAGGAGACTTGATTAAGTCAGACCCTTCAGGTCACTTAACTGGG
ATGGTTGGCACTGCTCTCTATGTAAGCCCAGAGGTCCAAGGAAGCACCAAATCTGCATAC
AACCAGAAAGTGGATCTCTTCAGCCTGGGAATTATCTTCTTTGAGATGTCCTATCACCCC
ATGGTCACGGCTTCAGAAAGGATCTTTGTTCTCAACCAACTCAGAGATCCCACTTCGCCT
AAGTTTCCAGAAGACTTTGACGATGGAGAGCATGCAAAGCAGAAATCAGTCATCTCCTGG
CTGTTGAACCACGATCCAGCAAAACGGCCCACAGCCACAGAACTGCTCAAGAGTGAGCTG
CTGCCCCCACCCCAGATGGAGGAGTCAGAGCTGCATGAAGTGCTGCACCACACGCTGACC
AACGTGGATGGGAAGGCCTACCGCACCATGATGGCCCAGATCTTCTCGCAGCGCATCTCC
CCTGCCATCGATTACACCTATGACAGCGACATACTGAAGGGCAACTTCTCAATCCGTACA
GCCAAGATGCAGCAGCATGTGTGTGAAACCATCATCCGCATCTTTAAAAGACATGGAGCT
GTTCAGTTGTGTACTCCACTACTGCTTCCCCGAAACAGACAAATATATGAGCACAACGAA
GCTGCCCTATTCATGGACCACAGCGGGATGCTGGTGATGCTTCCTTTTGACCTGCGGATC
CCTTTTGCAAGATATGTGGCAAGAAATAATATATTGAATTTAAAACGATACTGCATAGAA
CGTGTGTTCAGGCCGCGCAAGTTAGATCGATTTCATCCCAAAGAACTTCTGGAGTGTGCA
TTTGATATTGTCACTTCTACCACCAACAGCTTTCTGCCCACTGCTGAAATTATCTACACT
ATCTATGAAATCATCCAAGAGTTTCCAGCACTTCAGGAAAGAAATTACAGTATTTATTTG
AACCATACCATGTTATTGAAAGCAATACTCTTACACTGTGGGATCCCAGAAGATAAACTC
AGTCAAGTCTACATTATTCTGTATGATGCTGTGACAGAGAAGCTGACGAGGAGAGAAGTG
GAAGCTAAATTTTGTAATCTGTCTTTGTCTTCTAATAGTCTGTGTCGACTCTACAAGTTT
ATTGAACAGAAGGGAGATTTGCAAGATCTTATGCCAACAATAAATTCATTAATAAAACAG
AAAACAGGTATTGCACAGTTGGTGAAGTATGGCTTAAAAGACCTAGAGGAGGTTGTTGGA
CTGTTGAAGAAACTCGGCATCAAGTTACAGGTCTTGATCAATTTGGGCTTGGTTTACAAG
GTGCAGCAGCACAATGGAATCATCTTCCAGTTTGTGGCTTTCATCAAACGAAGGCAAAGG
GCTGTACCTGAAATCCTCGCAGCTGGAGGCAGATATGACCTGCTGATTCCCCAGTTTAGA
GGGCCACAAGCTCTGGGGCCAGTTCCCACTGCCATTGGGGTCAGCATAGCTATAGACAAG
ATATCTGCTGCTGTCCTCAACATGGAGGAATCTGTTACAATAAGCTCTTGTGACCTCCTG
GTTGTAAGTGTTGGCCAGATGTCTATGTCCAGGGCCATCAACCTAACCCAGAAACTCTGG
ACAGCAGGCATCACAGCAGAAATCATGTACGACTGGTCACAGTCCCAAGAGGAATTACAA
GAGTACTGCAGACATCATGAAATCACCTATGTGGCCCTTGTCTCGGATAAAGAAGGAAGC
CATGTCAAGGTTAAGTCTTTCGAGAAGGAAAGGCAGACAGAGAAGCGTGTGCTGGAGACT
GAACTTGTGGACCATGTACTGCAGAAACTGAGGACTAAAGTCACTGATGAAAGGAATGGC
AGAGAAGCTTCCGATAATCTTGCAGTGCAAAATCTGAAGGGGTCATTTTCTAATGCTTCA
GGTTTGTTTGAAATCCATGGAGCAACAGTGGTTCCCATTGTGAGTGTGCTAGCCCCGGAG
AAGCTGTCAGCCAGCACTAGGAGGCGCTATGAAACTCAGGTACAAACTCGACTTCAGACC
TCCCTTGCCAACTTACATCAGAAAAGCAGTGAAATTGAAATTCTGGCTGTGGATCTACCC
AAAGAAACAATATTACAGTTTTTATCATTAGAGTGGGATGCTGATGAACAGGCATTTAAC
ACAACTGTGAAGCAGCTGCTGTCACGCCTGCCAAAGCAAAGATACCTCAAATTAGTCTGT
GATGAAATTTATAACATCAAAGTAGAAAAAAAGGTGTCTGTGCTATTTCTGTACAGCTAT
AGAGATGACTACTACAGAATCTTATTTTAA
Protein Properties
Number of Residues 1649
Molecular Weight 186908.9
Theoretical pI 6.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Eukaryotic translation initiation factor 2-alpha kinase 4
MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLY
PQGLTGEEVYVKVDLRVKCPPTYPDVVPEIELKNAKGLSNESVNLLKSRLEELAKKHCGE
VMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQ
RRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHR
ANSSGRSRRERQYSVCNSEDSPGSCEILYFNMGSPDQLMVHKGKCIGSDEQLGKLVYNAL
ETATGGFVLLYEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTETEFNSLVKLSHPNVVR
YLAMNLKEQDDSIVVDILVEHISGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDYLHSNS
VVHKVLSASNVLVDAEGTVKITDYSISKRLADICKEDVFEQTRVRFSDNALPYKTGKKGD
VWRLGLLLLSLSQGQECGEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQPKMPLVEQSPEDSEGQDYVETVIPSNRLPSAAFFSETQRQFSRYFIEFEELQLLGKGA
FGAVIKVQNKLDGCCYAVKRIPINPASRQFRRIKGEVTLLSRLHHENIVRYYNAWIERHE
RPAGPGTPPPDSGPLAKDDRAARGQPASDTDGLDSVEAAAPPPILSSSVEWSTSGERSAS
ARFPATGPGSSDDEDDDEDEHGGVFSQSFLPASDSESDIIFDNEDENSKSQNQDEDCNEK
NGCHESEPSVTTEAVHYLYIQMEYCEKSTLRDTIDQGLYRDTVRLWRLFREILDGLAYIH
EKGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFSADSKQDDQTGDLIKSDPSGHLTG
MVGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPTSP
KFPEDFDDGEHAKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHTLT
NVDGKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGA
VQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLRIPFARYVARNNILNLKRYCIE
RVFRPRKLDRFHPKELLECAFDIVTSTTNSFLPTAEIIYTIYEIIQEFPALQERNYSIYL
NHTMLLKAILLHCGIPEDKLSQVYIILYDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKF
IEQKGDLQDLMPTINSLIKQKTGIAQLVKYGLKDLEEVVGLLKKLGIKLQVLINLGLVYK
VQQHNGIIFQFVAFIKRRQRAVPEILAAGGRYDLLIPQFRGPQALGPVPTAIGVSIAIDK
ISAAVLNMEESVTISSCDLLVVSVGQMSMSRAINLTQKLWTAGITAEIMYDWSQSQEELQ
EYCRHHEITYVALVSDKEGSHVKVKSFEKERQTEKRVLETELVDHVLQKLRTKVTDERNG
REASDNLAVQNLKGSFSNASGLFEIHGATVVPIVSVLAPEKLSASTRRRYETQVQTRLQT
SLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVC
DEIYNIKVEKKVSVLFLYSYRDDYYRILF
GenBank ID Protein 65287717
UniProtKB/Swiss-Prot ID Q9P2K8
UniProtKB/Swiss-Prot Entry Name E2AK4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001013703.2
GeneCard ID EIF2AK4
GenAtlas ID EIF2AK4
HGNC ID HGNC:19687
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  9. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]
  10. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  11. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Feb 28;7(1):65-73. [PubMed:10718198 ]
  12. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  13. Berlanga JJ, Santoyo J, De Haro C: Characterization of a mammalian homolog of the GCN2 eukaryotic initiation factor 2alpha kinase. Eur J Biochem. 1999 Oct;265(2):754-62. [PubMed:10504407 ]