You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09493
Secondary Accession Numbers
  • 15388
Name Cell division cycle 7-related protein kinase
Synonyms
  1. CDC7-related kinase
  2. HsCdc7
  3. huCdc7
Gene Name CDC7
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Seems to phosphorylate critical substrates that regulate the G1/S phase transition and/or DNA replication. Can phosphorylates MCM2 and MCM3
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 1p22
SNPs CDC7
Gene Sequence
>1725 bp
ATGGAGGCGTCTTTGGGGATTCAGATGGATGAGCCAATGGCTTTTTCTCCCCAGCGTGAC
CGGTTTCAGGCTGAAGGCTCTTTAAAAAAAAACGAGCAGAATTTTAAACTTGCAGGTGTT
AAAAAAGATATTGAGAAGCTTTATGAAGCTGTACCACAGCTTAGTAATGTGTTTAAGATT
GAGGACAAAATTGGAGAAGGCACTTTCAGCTCTGTTTATTTGGCCACAGCACAGTTACAA
GTAGGACCTGAAGAGAAAATTGCTCTAAAACACTTGATTCCAACAAGTCATCCTATAAGA
ATTGCAGCTGAACTTCAGTGCCTAACAGTGGCTGGGGGGCAAGATAATGTCATGGGAGTT
AAATACTGCTTTAGGAAGAATGATCATGTAGTTATTGCTATGCCATATCTGGAGCATGAG
TCGTTTTTGGACATTCTGAATTCTCTTTCCTTTCAAGAAGTACGGGAATATATGCTTAAT
CTGTTCAAAGCTTTGAAACGCATTCATCAGTTTGGTATTGTTCACCGTGATGTTAAGCCC
AGCAATTTTTTATATAATAGGCGCCTGAAAAAGTATGCCTTGGTAGACTTTGGTTTGGCC
CAAGGAACCCATGATACGAAAATAGAGCTTCTTAAATTTGTCCAGTCTGAAGCTCAGCAG
GAAAGGTGTTCACAAAACAAATCCCACATAATCACAGGAAACAAGATTCCACTGAGTGGC
CCAGTACCTAAGGAGCTGGATCAGCAGTCCACCACAAAAGCTTCTGTTAAAAGACCCTAC
ACAAATGCACAAATTCAGATTAAACAAGGAAAAGACGGAAAGGAGGGATCTGTAGGCCTT
TCTGTCCAGCGCTCTGTTTTTGGAGAAAGAAATTTCAATATACACAGCTCCATTTCACAT
GAGAGCCCTGCAGTGAAACTCATGAAGCAGTCAAAGACTGTGGATGTACTGTCTAGAAAG
TTAGCAACAAAAAAGAAGGCTATTTCTACGAAAGTTATGAATAGTGCTGTGATGAGGAAA
ACTGCCAGTTCTTGCCCAGCTAGCCTGACCTGTGACTGCTATGCAACAGATAAAGTTTGT
AGTATTTGCCTTTCAAGGCGTCAGCAGGTTGCCCCTAGGGCAGGTACACCAGGATTCAGA
GCACCAGAGGTCTTGACAAAGTGCCCCAATCAAACTACAGCAATTGACATGTGGTCTGCA
GGTGTCATATTTCTTTCTTTGCTTAGTGGACGATATCCATTTTATAAAGCAAGTGATGAT
TTAACTGCTTTGGCCCAAATTATGACAATTAGGGGATCCAGAGAAACTATCCAAGCTGCT
AAAACTTTTGGGAAATCAATATTATGTAGCAAAGAAGTTCCAGCACAAGACTTGAGAAAA
CTCTGTGAGAGACTCAGGGGTATGGATTCTAGCACTCCCAAGTTAACAAGTGATATACAA
GGGCATGCTTCTCATCAACCAGCTATTTCAGAGAAGACTGACCATAAAGCTTCTTGCCTC
GTTCAAACACCTCCAGGACAATACTCAGGGAATTCATTTAAAAAGGGGGATAGTAATAGC
TGTGAGCATTGTTTTGATGAGTATAATACCAATTTAGAAGGCTGGAATGAGGTACCTGAT
GAAGCTTATGACCTGCTTGATAAACTTCTAGATCTAAATCCAGCTTCAAGAATAACAGCA
GAAGAAGCTTTGTTGCATCCATTTTTTAAAGATATGAGCTTGTGA
Protein Properties
Number of Residues 574
Molecular Weight 63887.6
Theoretical pI 8.99
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cell division cycle 7-related protein kinase
MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKI
EDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGV
KYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKP
SNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSG
PVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
ESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATDKVC
SICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD
LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQ
GHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPD
EAYDLLDKLLDLNPASRITAEEALLHPFFKDMSL
GenBank ID Protein 2102637
UniProtKB/Swiss-Prot ID O00311
UniProtKB/Swiss-Prot Entry Name CDC7_HUMAN
PDB IDs Not Available
GenBank Gene ID AB003698
GeneCard ID CDC7
GenAtlas ID CDC7
HGNC ID HGNC:1745
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  7. Sato N, Arai K, Masai H: Human and Xenopus cDNAs encoding budding yeast Cdc7-related kinases: in vitro phosphorylation of MCM subunits by a putative human homologue of Cdc7. EMBO J. 1997 Jul 16;16(14):4340-51. [PubMed:9250678 ]
  8. Hess GF, Drong RF, Weiland KL, Slightom JL, Sclafani RA, Hollingsworth RE: A human homolog of the yeast CDC7 gene is overexpressed in some tumors and transformed cell lines. Gene. 1998 Apr 28;211(1):133-40. [PubMed:9573348 ]
  9. Jiang W, Hunter T: Identification and characterization of a human protein kinase related to budding yeast Cdc7p. Proc Natl Acad Sci U S A. 1997 Dec 23;94(26):14320-5. [PubMed:9405610 ]
  10. Kumagai H, Sato N, Yamada M, Mahony D, Seghezzi W, Lees E, Arai K, Masai H: A novel growth- and cell cycle-regulated protein, ASK, activates human Cdc7-related kinase and is essential for G1/S transition in mammalian cells. Mol Cell Biol. 1999 Jul;19(7):5083-95. [PubMed:10373557 ]
  11. Montagnoli A, Bosotti R, Villa F, Rialland M, Brotherton D, Mercurio C, Berthelsen J, Santocanale C: Drf1, a novel regulatory subunit for human Cdc7 kinase. EMBO J. 2002 Jun 17;21(12):3171-81. [PubMed:12065429 ]
  12. Yoshizawa-Sugata N, Ishii A, Taniyama C, Matsui E, Arai K, Masai H: A second human Dbf4/ASK-related protein, Drf1/ASKL1, is required for efficient progression of S and M phases. J Biol Chem. 2005 Apr 1;280(13):13062-70. Epub 2005 Jan 24. [PubMed:15668232 ]
  13. Tenca P, Brotherton D, Montagnoli A, Rainoldi S, Albanese C, Santocanale C: Cdc7 is an active kinase in human cancer cells undergoing replication stress. J Biol Chem. 2007 Jan 5;282(1):208-15. Epub 2006 Oct 24. [PubMed:17062569 ]