You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09496
Secondary Accession Numbers
  • 15391
Name Microtubule-associated serine/threonine-protein kinase-like
Synonyms Not Available
Gene Name MASTL
Protein Type Enzyme
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function Putative serine/threonine kinase which may be involved in megakaryocyte differentiation
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 10p12.1
SNPs MASTL
Gene Sequence
>2640 bp
ATGGATCCCACCGCGGGAAGCAAGAAGGAGCCTGGAGGAGGCGCGGCGACTGAGGAGGGC
GTGAATAGGATCGCAGTGCCAAAACCGCCCTCCATTGAGGAATTCAGCATAGTGAAGCCC
ATTAGCCGGGGCGCCTTCGGGAAAGTGTATCTGGGGCAGAAAGGCGGCAAATTGTATGCA
GTAAAGGTTGTTAAAAAAGCAGACATGATCAACAAAAATATGACTCATCAGGTCCAAGCT
GAGAGAGATGCACTGGCACTAAGCAAAAGCCCATTCATTGTCCATTTGTATTATTCACTG
CAGTCTGCAAACAATGTCTACTTGGTAATGGAATATCTTATTGGGGGAGATGTCAAGTCT
CTCCTACATATATATGGTTATTTTGATGAAGAGATGGCTGTGAAATATATTTCTGAAGTA
GCACTGGCTCTAGACTACCTTCACAGACATGGAATCATCCACAGGGACTTGAAACCGGAC
AATATGCTTATTTCTAATGAGGGTCATATTAAACTGACGGATTTTGGCCTTTCAAAAGTT
ACTTTGAATAGAGATATTAATATGATGGATATCCTTACAACACCATCAATGGCAAAACCT
AGACAAGATTATTCAAGAACCCCAGGACAAGTGTTATCGCTTATCAGCTCGTTGGGATTT
AACACACCAATTGCAGAAAAAAATCAAGACCCTGCAAACATCCTTTCAGCCTGTCTGTCT
GAAACATCACAGCTTTCTCAAGGACTCGTATGCCCTATGTCTGTAGATCAAAAGGACACT
ACGCCTTATTCTAGCAAATTACTAAAATCATGTCTTGAAACAGTTGCCTCCAACCCAGGA
ATGCCTGTGAAGTGTCTAACTTCTAATTTACTCCAGTCTAGGAAAAGGCTGGCCACATCC
AGTGCCAGTAGTCAATCCCACACCTTCATATCCAGTGTGGAATCAGAATGCCACAGCAGT
CCCAAATGGGAAAAAGATTGCCAGGAAAGTGATGAAGCATTGGGCCCAACAATGATGAGT
TGGAATGCAGTTGAAAAGTTATGCGCAAAATCTGCAAATGCCATTGAGACGAAAGGTTTC
AATAAAAAGGATCTGGAGTTAGCTCTTTCTCCCATTCATAACAGCAGTGCCCTTCCCACC
ACTGGACGCTCTTGTGTAAACCTTGCTAAAAAATGCTTCTCTGGGGAAGTTTCTTGGGAA
GCAGTAGAACTGGATGTAAATAATATAAATATGGACACTGACACAAGTCAGTTAGGTTTC
CATCAGTCAAATCAGTGGGCTGTGGATTCTGGTGGGATATCTGAAGAGCACCTTGGGAAA
AGAAGTTTAAAAAGAAATTTTGAGTTGGTTGACTCCAGTCCTTGTAAAAAAATTATACAG
AATAAAAAAACTTGTGTAGAGTATAAGCATAACGAAATGACAAATTGTTATACAAATCAA
AATACAGGCTTAACAGTTGAAGTGCAGGACCTTAAGCTATCAGTGCACAAAAGTCAACAA
AATGACTGTGCTAATAAGGAGAACATTGTCAATTCTTTTACTGATAAACAACAAACACCA
GAAAAATTACCTATACCAATGATAGCAAAAAACCTTATGTGTGAACTCGATGAAGACTGT
GAAAAGAATAGTAAGAGGGACTACTTAAGTTCTAGTTTTCTATGTTCTGATGATGATAGA
GCTTCTAAAAATATTTCTATGAACTCTGATTCATCTTTTCCTGGAATTTCTATAATGGAA
AGTCCATTAGAAAGTCAGCCCTTAGATTCAGATAGAAGCATCAAAGAATCCTCTTTTGAA
GAATCAAATATTGAAGATCCACTTATTGTAACACCAGATTGCCAAGAAAAGACCTCACCA
AAAGGTGTCGAGAACCCTGCTGTACAAGAGAGTAACCAAAAAATGTTAGGTCCTCCTTTG
GAGGTGCTGAAAACGTTAGCCTCTAAAAGAAATGCTGTTGCTTTTCGAAGTTTTAACAGT
CATATTAATGCATCCAATAACTCAGAACCATCCAGAATGAACATGACTTCTTTAGATGCA
ATGGATATTTCGTGTGCCTACAGTGGTTCATATCCCATGGCTATAACCCCTACTCAAAAA
AGAAGATCCTGTATGCCACATCAGCAGACCCCAAATCAGATCAAGTCGGGAACTCCATAC
CGAACTCCGAAGAGTGTGAGAAGAGGGGTGGCCCCCGTTGATGATGGGCGAATTCTAGGA
ACCCCAGACTACCTTGCACCTGAGCTGTTACTAGGCAGGGCCCATGGTCCTGCGGTAGAC
TGGTGGGCACTTGGAGTTTGCTTGTTTGAATTTCTAACAGGAATTCCCCCTTTCAATGAT
GAAACACCACAACAAGTATTCCAGAATATTCTGAAAAGAGATATCCCTTGGCCAGAAGGT
GAAGAAAAGTTATCTGATAATGCTCAAAGTGCAGTAGAAATACTTTTAACCATTGATGAT
ACAAAGAGAGCTGGAATGAAAGAGCTAAAACGTCATCCTCTCTTCAGTGATGTGGACTGG
GAAAATCTGCAGCATCAGACTATGCCTTTCATCCCCCAGCCAGATGATGAAACAGATACC
TCCTATTTTGAAGCCAGGAATACTGCTCAGCACCTGACTGTATCTGGATTTAGTCTGTAG
Protein Properties
Number of Residues 879
Molecular Weight 97318.1
Theoretical pI 5.84
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Microtubule-associated serine/threonine-protein kinase-like
MDPTAGSKKEPGGGAATEEGVNRIAVPKPPSIEEFSIVKPISRGAFGKVYLGQKGGKLYA
VKVVKKADMINKNMTHQVQAERDALALSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKS
LLHIYGYFDEEMAVKYISEVALALDYLHRHGIIHRDLKPDNMLISNEGHIKLTDFGLSKV
TLNRDINMMDILTTPSMAKPRQDYSRTPGQVLSLISSLGFNTPIAEKNQDPANILSACLS
ETSQLSQGLVCPMSVDQKDTTPYSSKLLKSCLETVASNPGMPVKCLTSNLLQSRKRLATS
SASSQSHTFISSVESECHSSPKWEKDCQESDEALGPTMMSWNAVEKLCAKSANAIETKGF
NKKDLELALSPIHNSSALPTTGRSCVNLAKKCFSGEVSWEAVELDVNNINMDTDTSQLGF
HQSNQWAVDSGGISEEHLGKRSLKRNFELVDSSPCKKIIQNKKTCVEYKHNEMTNCYTNQ
NTGLTVEVQDLKLSVHKSQQNDCANKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDC
EKNSKRDYLSSSFLCSDDDRASKNISMNSDSSFPGISIMESPLESQPLDSDRSIKESSFE
ESNIEDPLIVTPDCQEKTSPKGVENPAVQESNQKMLGPPLEVLKTLASKRNAVAFRSFNS
HINASNNSEPSRMNMTSLDAMDISCAYSGSYPMAITPTQKRRSCMPHQQTPNQIKSGTPY
RTPKSVRRGVAPVDDGRILGTPDYLAPELLLGRAHGPAVDWWALGVCLFEFLTGIPPFND
ETPQQVFQNILKRDIPWPEGEEKLSDNAQSAVEILLTIDDTKRAGMKELKRHPLFSDVDW
ENLQHQTMPFIPQPDDETDTSYFEARNTAQHLTVSGFSL
GenBank ID Protein 288806587
UniProtKB/Swiss-Prot ID Q96GX5
UniProtKB/Swiss-Prot Entry Name MASTL_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001172303.1
GeneCard ID MASTL
GenAtlas ID MASTL
HGNC ID HGNC:19042
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  7. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  8. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  9. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  10. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  11. Gandhi MJ, Cummings CL, Drachman JG: FLJ14813 missense mutation: a candidate for autosomal dominant thrombocytopenia on human chromosome 10. Hum Hered. 2003;55(1):66-70. [PubMed:12890928 ]