You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09509
Secondary Accession Numbers
  • 15408
Name Serine/threonine-protein kinase N3
Synonyms
  1. Protein kinase PKN-beta
  2. Protein-kinase C-related kinase 3
Gene Name PKN3
Protein Type Enzyme
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function Contributes to invasiveness in malignant prostate cancer
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
biological regulation
regulation of biological process
cellular metabolic process
regulation of cellular process
signal transduction
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. perinuclear region
Gene Properties
Chromosome Location Chromosome:9
Locus 9q34.11
SNPs PKN3
Gene Sequence
>2670 bp
ATGGAGGAGGGGGCGCCGCGGCAGCCTGGGCCGAGCCAGTGGCCCCCAGAGGATGAGAAG
GAGGTGATCCGCCGGGCCATCCAGAAAGAGCTGAAGATCAAGGAGGGGGTGGAGAACCTG
CGGCGCGTGGCCACAGACCGCCGCCACTTGGGCCATGTGCAGCAGCTGCTGCGGTCCTCC
AACCGCCGCCTGGAGCAGCTGCATGGCGAGCTGCGGGAGCTGCACGCCCGAATCCTGCTG
CCCGGCCCTGGGCCTGGCCCAGCTGAGCCTGTGGCCTCAGGACCCCGGCCGTGGGCAGAG
CAGCTCAGGGCTCGGCACCTAGAGGCTCTCCGGAGGCAGCTGCATGTGGAGCTGAAGGTG
AAACAGGGGGCTGAGAACATGACCCACACGTGCGCCAGTGGCACCCCCAAGGAGAGGAAG
CTCCTTGCAGCTGCCCAGCAGATGCTGCGGGACAGCCAGCTGAAGGTGGCCCTGCTGCGG
ATGAAGATCAGCAGCCTGGAGGCCAGTGGGTCCCCGGAGCCAGGGCCTGAGCTACTGGCG
GAGGAGCTACAGCATCGACTGCACGTTGAGGCAGCGGTGGCTGAGGGCGCCAAGAACGTG
GTGAAACTGCTTAGTAGCCGGAGAACACAGGACCGCAAGGCACTGGCTGAGGCCCAGGCC
CAGCTACAGGAGTCCTCTCAGAAACTGGACCTCCTGCGCCTGGCCTTGGAGCAGCTGCTG
GAGCAACTGCCTCCTGCCCACCCTTTGCGCAGCAGAGTGACCCGAGAGTTGCGGGCTGCG
GTGCCTGGATACCCCCAGCCTTCAGGGACACCTGTGAAGCCCACCGCCCTAACAGGGACA
CTGCAGGTCCGCCTCCTGGGCTGTGAACAGTTGCTGACAGCCGTGCCTGGGCGCTCCCCA
GCGGCCGCACTGGCCAGCAGCCCCTCCGAGGGCTGGCTTCGGACCAAGGCCAAGCACCAG
CGTGGCCGAGGCGAGCTTGCCAGTGAGGTGCTGGCTGTGCTAAAGGTGGACAACCGTGTT
GTGGGGCAGACGGGCTGGGGGCAGGTGGCCGAACAGTCCTGGGACCAGACCTTTGTCATC
CCACTGGAGCGAGCCCGTGAGCTGGAGATTGGGGTACACTGGCGGGACTGGCGGCAGCTA
TGTGGCGTGGCCTTCCTGAGACTTGAAGACTTCCTGGACAATGCCTGTCACCAACTGTCC
CTCAGCCTGGTACCGCAGGGACTGCTTTTTGCCCAGGTGACCTTCTGCGATCCTGTCATT
GAGAGGCGGCCCCGGCTGCAGAGGCAGGAACGCATCTTCTCTAAACGCAGAGGCCAGGAC
TTCCTGAGGCGTTCGCAGATGAACCTCGGCATGGCGGCCTGGGGGCGCCTCGTCATGAAC
CTGCTGCCCCCCTGCAGCTCCCCGAGCACAATCAGCCCCCCTAAAGGATGCCCTCGGACC
CCAACAACACTGCGAGAGGCCTCTGACCCTGCCACTCCCAGTAATTTCCTGCCCAAGAAG
ACCCCCTTGGGTGAAGAGATGACACCCCCACCCAAGCCCCCACGCCTCTACCTCCCCCAG
GAGCCAACATCCGAGGAGACTCCGCGCACCAAACGTCCCCATATGGAGCCTAGGACTCGA
CGTGGGCCATCTCCACCAGCCTCCCCCACCAGGAAACCCCCTCGGCTTCAGGACTTCCGC
TGCTTAGCTGTGCTGGGCCGGGGACACTTTGGGAAGGTCCTCCTGGTCCAGTTCAAGGGG
ACAGGGAAATACTACGCCATCAAAGCACTGAAGAAGCAGGAGGTGCTCAGCCGGGACGAG
ATAGAGAGCCTGTACTGCGAGAAGCGGATCCTGGAGGCTGTGGGCTGCACAGGGCACCCT
TTCCTGCTCTCCCTCCTTGTCTGCTTCCAGACCTCCAGCCATGCCCGCTTTGTGACTGAG
TTTGTGCCTGGTGGTGACCTCATGATGCAGATCCACGAGGATGTCTTCCCCGAGCCCCAG
GCCCGCTTCTACGTGGCTTGTGTTGTCCTGGGGCTGCAGTTCTTACACGAGAAGAAGATC
ATTTACAGGGACCTGAAGTTGGATAACCTTCTGCTGGATGCCCAGGGATTCCTGAAGATC
GCAGACTTTGGACTCTGCAAGGAAGGGATCGGCTTCGGGGACCGGACTAGCACCTTCTGT
GGCACCCCGGAGTTCCTGGCTCCCGAGGTGCTGACCCAGGAGGCATACACACAGGCCGTC
GACTGGTGGGCGCTGGGTGTGCTGCTCTACGAGATGCTGGTGGGTGAGTGCCCGTTCCCA
GGGGACACAGAGGAAGAGGTGTTTGACTGCATCGTCAACATGGACGCCCCCTACCCCGGC
TTTCTGTCGGTGCAAGGGCTTGAGTTCATTCAGAAGCTCCTCCAGAAGTGCCCGGAGAAG
CGCCTCGGGGCAGGTGAGCAGGATGCCGAGGAGATCAAGGTCCAGCCATTCTTCAGGACC
ACCAACTGGCAAGCCCTGCTCGCCCGCACCATCCAGCCCCCCTTCGTGCCTACCCTGTGT
GGCCCTGCGGACCTGCGCTACTTTGAGGGCGAGTTCACAGGGCTGCCGCCTGCCCTGACC
CCACCTGCACCCCACAGCCTCCTCACTGCCCGCCAACAGGCCGCCTTCCGGGACTTCGAC
TTTGTGTCAGAGCGATTCCTGGAACCCTGA
Protein Properties
Number of Residues 889
Molecular Weight 99419.8
Theoretical pI 8.56
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase N3
MEEGAPRQPGPSQWPPEDEKEVIRRAIQKELKIKEGVENLRRVATDRRHLGHVQQLLRSS
NRRLEQLHGELRELHARILLPGPGPGPAEPVASGPRPWAEQLRARHLEALRRQLHVELKV
KQGAENMTHTCASGTPKERKLLAAAQQMLRDSQLKVALLRMKISSLEASGSPEPGPELLA
EELQHRLHVEAAVAEGAKNVVKLLSSRRTQDRKALAEAQAQLQESSQKLDLLRLALEQLL
EQLPPAHPLRSRVTRELRAAVPGYPQPSGTPVKPTALTGTLQVRLLGCEQLLTAVPGRSP
AAALASSPSEGWLRTKAKHQRGRGELASEVLAVLKVDNRVVGQTGWGQVAEQSWDQTFVI
PLERARELEIGVHWRDWRQLCGVAFLRLEDFLDNACHQLSLSLVPQGLLFAQVTFCDPVI
ERRPRLQRQERIFSKRRGQDFLRASQMNLGMAAWGRLVMNLLPPCSSPSTISPPKGCPRT
PTTLREASDPATPSNFLPKKTPLGEEMTPPPKPPRLYLPQEPTSEETPRTKRPHMEPRTR
RGPSPPASPTRKPPRLQDFRCLAVLGRGHFGKVLLVQFKGTGKYYAIKALKKQEVLSRDE
IESLYCEKRILEAVGCTGHPFLLSLLACFQTSSHACFVTEFVPGGDLMMQIHEDVFPEPQ
ARFYVACVVLGLQFLHEKKIIYRDLKLDNLLLDAQGFLKIADFGLCKEGIGFGDRTSTFC
GTPEFLAPEVLTQEAYTRAVDWWGLGVLLYEMLVGECPFPGDTEEEVFDCIVNMDAPYPG
FLSVQGLEFIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQALLARTIQPPFVPTLC
GPADLRYFEGEFTGLPPALTPPAPHSLLTARQQAAFRDFDFVSERFLEP
GenBank ID Protein 6088096
UniProtKB/Swiss-Prot ID Q6P5Z2
UniProtKB/Swiss-Prot Entry Name PKN3_HUMAN
PDB IDs Not Available
GenBank Gene ID AB019692
GeneCard ID PKN3
GenAtlas ID PKN3
HGNC ID HGNC:17999
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  5. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  6. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  7. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  8. Oishi K, Mukai H, Shibata H, Takahashi M, Ona Y: Identification and characterization of PKNbeta, a novel isoform of protein kinase PKN: expression and arachidonic acid dependency are different from those of PKNalpha. Biochem Biophys Res Commun. 1999 Aug 11;261(3):808-14. [PubMed:10441506 ]
  9. Leenders F, Mopert K, Schmiedeknecht A, Santel A, Czauderna F, Aleku M, Penschuck S, Dames S, Sternberger M, Rohl T, Wellmann A, Arnold W, Giese K, Kaufmann J, Klippel A: PKN3 is required for malignant prostate cell growth downstream of activated PI 3-kinase. EMBO J. 2004 Aug 18;23(16):3303-13. Epub 2004 Jul 29. [PubMed:15282551 ]