You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09523
Secondary Accession Numbers
  • 15427
Name Tau-tubulin kinase 2
Synonyms Not Available
Gene Name TTBK2
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Serine/threonine kinase which is able to phosphorylate tau on serines
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 15q15.2
SNPs TTBK2
Gene Sequence
>3735 bp
ATGAGTGGGGGAGGAGAGCAGCTGGATATCCTGAGTGTTGGAATCCTAGTGAAAGAAAGA
TGGAAAGTGTTGAGAAAGATTGGGGGTGGGGGCTTTGGAGAAATTTACGATGCCTTGGAC
ATGCTCACCAGGGAAAATGTTGCACTGAAGGTGGAATCAGCTCAACAACCAAAACAAGTT
CTGAAAATGGAAGTTGCTGTTTTGAAAAAGCTGCAAGGGAAAGACCATGTTTGTAGATTT
ATTGGCTGTGGGAGGAATGATCGATTCAACTATGTGGTCATGCAGTTGCAGGGTCGGAAT
CTGGCAGATCTTCGCCGTAGCCAGTCCCGAGGCACATTCACCATTAGTACCACTCTCCGG
CTGGGTAGACAGATTTTGGAGTCTATTGAAAGCATTCATTCTGTGGGATTCTTGCATCGA
GACATCAAACCGTCGAACTTCGCTATGGGTCGCTTTCCTAGTACATGTAGGAAATGTTAC
ATGCTTGATTTTGGCTTGGCTCGACAATTTACCAATTCCTGTGGTGACGTCAGACCACCT
CGAGCTGTGGCAGGTTTTCGAGGGACAGTTCGTTATGCATCAATCAACGCACATCGGAAC
AGGGAAATGGGAAGACATGATGACCTTTGGTCCTTATTCTACATGTTGGTGGAGTTTGTG
GTTGGTCAGCTGCCCTGGAGAAAAATAAAGGACAAGGAGCAAGTAGGCTCTATTAAGGAG
AGATATGACCACAGGCTCATGTTGAAACATCTCCCTCCAGAATTCAGCATCTTTCTAGAC
CATATCTCTTCTTTGGATTATTTTACAAAACCAGACTACCAGCTTCTTACATCCGTGTTT
GACAATAGCATCAAGACTTTTGGAGTAATTGAGAGTGACCCTTTTGACTGGGAGAAGACT
GGAAATGATGGCTCCCTAACAACCACCACTACTTCTACCACCCCTCAGTTGCACACTCGC
TTGACCCCTGCTGCAATTGGAATTGCCAATGCTACTCCCATCCCTGGAGACTTGCTTCGA
GAAAATACAGATGAGGTATTTCCAGATGAACAGCTTAGCGATGGAGAAAATGGCATCCCT
GTTGGTGTGTCACCAGATAAATTGCCTGGATCTCTGGGACACCCCCGTCCCCAGGAGAAG
GATGTTTGGGAAGAGATGGATGCCAACAAAAACAAGATAAAGCTTGGAATTTGTAAGGCT
GCTACTGAAGAGGAGAACAGCCATGGCCAGGCAAATGGTCTTCTCAATGCTCCAAGCCTT
GGGTCACCAATTCGTGTCCGCTCAGAGATTACTCAGCCAGACAGAGATATTCCACTGGTG
CGAAAGTTACGTTCCATTCACAGCTTTGAGCTGGAAAAACGTCTGACCCTGGAGCCAAAG
CCAGACACTGACAAGTTCCTTGAGACCTGCCTGGAGAAAATGCAGAAAGATACCAGTGCA
GGAAAAGAATCTATTCTCCCTGCTCTGCTGCATAAGCCTTGCGTTCCTGCTGTGTCCCGT
ACTGACCACATCTGGCACTATGATGAAGAATATCTTCCAGATGCCTCCAAGCCTGCTTCT
GCCAACACCCCTGAGCAGGCAGATGGTGGTGGCAGCAATGGATTTATAGCTGTTAACCTG
AGCTCTTGCAAGCAAGAAATTGATTCCAAAGAATGGGTGATTGTGGACAAGGAGCAGGAC
CTTCAGGATTTTAGGACAAATGAGGCTGTAGGACATAAAACAACTGGAAGTCCTTCTGAT
GAGGAGCCTGAAGTACTTCAAGTCCTGGAGGCATCACCTCAAGATGAAAAGCTCCAGTTA
GGTCCTTGGGCAGAAAATGATCATTTAAAGAAGGAAACCTCAGGTGTGGTCTTAGCACTT
TCTGCAGAGGGTCCTCCTACTGCTGCTTCAGAACAATATACAGATAGGCTGGAACTCCAG
CCTGGAGCTGCTAGTCAGTTTATTGCAGCGACGCCCACAAGTCTAATGGAGGCGCAGGCA
GAAGGACCCCTTACAGCGATTACAATTCCTAGACCTTCTGTGGCATCTACACAGTCAACT
TCAGGAAGCTTTCACTGTGGTCAGCAGCCAGAGAAGAAAGATCTTCAGCCCATGGAGCCC
ACTGTGGAACTTTACTCTCCAAGGGAAAACTTCTCTGGCTTGGTTGTGACAGAGGGTGAA
CCTCCTAGTGGAGGAAGCAGAACAGATTTGGGGCTTCAGATAGATCACATTGGTCATGAC
ATGTTACCCAACATTAGAGAAAGTAACAAATCTCAAGACCTGGGACCAAAAGAACTTCCT
GATCATAATAGACTGGTTGTGAGAGAATTTGAAAATCTCCCTGGGGAAACTGAAGAGAAA
AGCATCCTTTTAGAGTCAGATAATGAAGATGAGAAGTTAAGTAGAGGGCAGCATTGTATT
GAGATCTCCTCTCTCCCAGGAGATTTGGTAATTGTGGAAAAGGATCACTCAGCTACTACT
GAACCTCTTGATGTGACAAAAACACAGACTTTTAGTGTGGTGCCAAATCAAGACAAAAAT
AATGAGATAATGAAGCTTCTGACAGTTGGAACTTCAGAAATTTCTTCCAGAGACATTGAC
CCACATGTTGAAGGTCAGATAGGCCAAGTGGCAGAAATGCAAAAAAATAAGATATCTAAG
GATGATGACATCATGAGTGAAGACTTGCCAGGTCATCAAGGAGACCTCTCTACTTTTTTG
CACCAAGAGGGCAAGAGAGAGAAAATCACCCCTAGAAATGGAGAACTATTTCATTGTGTT
TCAGAGAATGAACATGGTGCCCCAACCCGGAAGGATATGGTTAGGTCATCCTTTGTAACT
AGACACAGCCGAATCCCTGTTTTAGCACAAGAGATAGACTCAACTTTGGAATCATCCTCT
CCAGTTTCTGCAAAAGAAAAGCTCCTCCAAAAGAAAGCCTATCAGCCAGACCTAGTCAAG
CTTCTGGTGGAAAAAAGACAATTCAAGTCCTTCCTTGGCGACCTCTCAAGTGCCTCTGAT
AAATTGCTAGAGGAGAAACTAGCTACTGTTCCTGCTCCCTTTTGTGAGGAGGAAGTGCTC
ACTCCCTTTTCAAGACTGACAGTAGATTCTCACCTGAGTAGGTCAGCTGAAGATAGCTTT
CTGTCACCCATCATCTCCCAGTCTAGAAAGAGCAAAATTCCAAGGCCAGTTTCATGGGTC
AACACAGATCAGGTCAATAGCTCAACTTCGTCTCAGTTCTTTCCTCGGCCACCACCAGGA
AAGCCACCCACGAGGCCTGGAGTAGAAGCCAGGCTACGCAGATATAAAGTCCTAGGGAGT
AGTAACTCCGACTCAGACCTTTTCTCCCGCCTGGCCCAAATTCTTCAAAATGGATCTCAG
AAACCCCGGAGCACTACTCAGTGCAAGAGTCCAGGATCTCCTCACAATCCAAAAACACCA
CCCAAGAGTCCAGTTGTCCCTCGCAGGAGTCCCAGTGCCTCTCCTCGAAGCTCATCCTTG
CCTCGCACGTCTAGTTCCTCACCATCTAGGGCTGGACGGCCCCACCATGACCAGAGGAGT
TCGTCCCCACATCTGGGGAGAAGCAAGTCACCTCCCAGCCACTCAGGATCTTCCTCCTCC
AGGAGGTCCTGCCAACAGGAGCATTGCAAACCCAGCAAGAATGGCCTGAAAGGATCCGGC
AGCCTCCACCACCACTCAGCCAGCACTAAAACCCCCCAAGGGAAGAGTAAGCCAGCCAGT
AAACTCAGCAGATAG
Protein Properties
Number of Residues 1244
Molecular Weight 137411.2
Theoretical pI 7.0
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Tau-tubulin kinase 2
MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQV
LKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLR
LGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPP
RAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKE
RYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWEKT
GNDGSLTTTTTSTTPQLHTRLTPAAIGIANATPIPGDLLRENTDEVFPDEQLSDGENGIP
VGVSPDKLPGSLGHPRPQEKDVWEEMDANKNKIKLGICKAATEEENSHGQANGLLNAPSL
GSPIRVRSEITQPDRDIPLVRKLRSIHSFELEKRLTLEPKPDTDKFLETCLEKMQKDTSA
GKESILPALLHKPCVPAVSRTDHIWHYDEEYLPDASKPASANTPEQADGGGSNGFIAVNL
SSCKQEIDSKEWVIVDKEQDLQDFRTNEAVGHKTTGSPSDEEPEVLQVLEASPQDEKLQL
GPWAENDHLKKETSGVVLALSAEGPPTAASEQYTDRLELQPGAASQFIAATPTSLMEAQA
EGPLTAITIPRPSVASTQSTSGSFHCGQQPEKKDLQPMEPTVELYSPRENFSGLVVTEGE
PPSGGSRTDLGLQIDHIGHDMLPNIRESNKSQDLGPKELPDHNRLVVREFENLPGETEEK
SILLESDNEDEKLSRGQHCIEISSLPGDLVIVEKDHSATTEPLDVTKTQTFSVVPNQDKN
NEIMKLLTVGTSEISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFL
HQEGKREKITPRNGELFHCVSENEHGAPTRKDMVRSSFVTRHSRIPVLAQEIDSTLESSS
PVSAKEKLLQKKAYQPDLVKLLVEKRQFKSFLGDLSSASDKLLEEKLATVPAPFCEEEVL
TPFSRLTVDSHLSRSAEDSFLSPIISQSRKSKIPRPVSWVNTDQVNSSTSSQFFPRPPPG
KPPTRPGVEARLRRYKVLGSSNSDSDLFSRLAQILQNGSQKPRSTTQCKSPGSPHNPKTP
PKSPVVPRRSPSASPRSSSLPRTSSSSPSRAGRPHHDQRSSSPHLGRSKSPPSHSGSSSS
RRSCQQEHCKPSKNGLKGSGSLHHHSASTKTPQGKSKPASKLSR
GenBank ID Protein 116812624
UniProtKB/Swiss-Prot ID Q6IQ55
UniProtKB/Swiss-Prot Entry Name TTBK2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_173500.3
GeneCard ID TTBK2
GenAtlas ID TTBK2
HGNC ID HGNC:19141
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  5. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. [PubMed:10048485 ]
  6. Houlden H, Johnson J, Gardner-Thorpe C, Lashley T, Hernandez D, Worth P, Singleton AB, Hilton DA, Holton J, Revesz T, Davis MB, Giunti P, Wood NW: Mutations in TTBK2, encoding a kinase implicated in tau phosphorylation, segregate with spinocerebellar ataxia type 11. Nat Genet. 2007 Dec;39(12):1434-6. Epub 2007 Nov 25. [PubMed:18037885 ]