You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09531
Secondary Accession Numbers
  • 15437
Name T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3 (T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3, isoform CRA_c)
Synonyms Not Available
Gene Name TCIRG1
Protein Type Enzyme
Biological Properties
General Function Energy production and conversion
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell
Process
hydrogen transport
proton transport
transport
physiological process
cellular physiological process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:11
Locus 11q13.2
SNPs Q8WVC5
Gene Sequence
>2493 bp
ATGGGCTCCATGTTCCGGAGCGAGGAGGTGGCCCTGGTCCAGCTCTTTCTGCCCACAGCG
GCTGCCTACACCTGCGTGAGTCGGCTGGGCGAGCTGGGCCTCGTGGAGTTCAGAGACCTC
AACGCCTCGGTGAGCGCCTTCCAGAGACGCTTTGTGGTTGATGTTCGGCGCTGTGAGGAG
CTGGAGAAGACCTTCACCTTCCTGCAGGAGGAGGTGCGGCGGGCTGGGCTGGTCCTGCCC
CCGCCAAAGGGGAGGCTGCCGGCACCCCCACCCCGGGACCTGCTGCGCATCCAGGAGGAG
ACGGAGCGCCTGGCCCAGGAGCTGCGGGATGTGCGGGGCAACCAGCAGGCCCTGCGGGCC
CAGCTGCACCAGCTGCAGCTCCACGCCGCCGTGCTACGCCAGGGCCATGAACCTCAGCTG
GCAGCCGCCCACACAGATGGGGCCTCAGAGAGGACGCCCCTGCTCCAGGCCCCCGGGGGG
CCGCACCAGGACCTGAGGGTCAACTTTGTGGCAGGTGCCGTGGAGCCCCACAAGGCCCCT
GCCCTAGAGCGCCTGCTCTGGAGGGCCTGCCGCGGCTTCCTCATTGCCAGCTTCAGGGAG
CTGGAGCAGCCGCTGGAGCACCCCGTGACGGGCGAGCCAGCCACGTGGATGACCTTCCTC
ATCTCCTACTGGGGTGAGCAGATCGGACAGAAGATCCGCAAGATCACGGACTGCTTCCAC
TGCCACGTCTTCCCGTTTCTGCAGCAGGAGGAGGCCCGCCTCGGGGCCCTGCAGCAGCTG
CAACAGCAGAGCCAGGAGCTGCAGGAGGTCCTCGGGGAGACAGAGCGGTTCCTGAGCCAG
GTGCTAGGCCGGGTGCTGCAGCTGCTGCCGCCAGGGCAGGTGCAGGTCCACAAGATGAAG
GCCGTGTACCTGGCCCTGAACCAGTGCAGCGTGAGCACCACGCACAAGTGCCTCATTGCC
GAGGCCTGGTGCTCTGTGCGAGACCTGCCCGCCCTGCAGGAGGCCCTGCGGGACAGCTCG
ATGGAGGAGGGAGTGAGTGCCGTGGCTCACCGCATCCCCTGCCGGGACATGCCCCCCACA
CTCATCCGCACCAACCGCTTCACGGCCAGCTTCCAGGGCATCGTGGATGCCTACGGCGTG
GGCCGCTACCAGGAGGTCAACCCCGCTCCCTACACCATCATCACCTTCCCCTTCCTGTTT
GCTGTGATGTTCGGGGATGTGGGCCACGGGCTGCTCATGTTCCTCTTCGCCCTGGCCATG
GTCCTTGCGGAGAACCGACCGGCTGTGAAGGCCGCGCAGAACGAGATCTGGCAGACTTTC
TTCAGGGGCCGCTACCTGCTCCTGCTTATGGGCCTGTTCTCCATCTACACCGGCTTCATC
TACAACGAGTGCTTCAGTCGCGCCACCAGCATCTTCCCCTCGGGCTGGAGTGTGGCCGCC
ATGGCCAACCAGTCTGGCTGGAGTGATGCATTCCTGGCCCAGCACACGATGCTTACCCTG
GATCCCAACGTCACCGGTGTCTTCCTGGGACCCTACCCCTTTGGCATCGATCCTATTTGG
AGCCTGGCTGCCAACCACTTGAGCTTCCTCAACTCCTTCAAGATGAAGATGTCCGTCATC
CTGGGCGTCGTGCACATGGCCTTTGGGGTGGTCCTCGGAGTCTTCAACCACGTGCACTTT
GGCCAGAGGCACCGGCTGCTGCTGGAGACGCTGCCGGAGCTCACCTTCCTGCTGGGACTC
TTCGGTTACCTCGTGTTCCTAGTCATCTACAAGTGGCTGTGTGTCTGGGCTGCCAGGGCC
GCCTCGGCCCCCAGCATCCTCATCCACTTCATCAACATGTTCCTCTTCTCCCACAGCCCC
AGCAACAGGCTGCTCTACCCCCGGCAGGAGGTGGTCCAGGCCACGCTGGTGGTCCTGGCC
TTGGCCATGGTGCCCATCCTGCTGCTTGGCACACCCCTGCACCTGCTGCACCGCCACCGC
CGCCGCCTGCGGAGGAGGCCCGCTGACCGACAGGAGGAAAACAAGGCCGGGTTGCTGGAC
CTGCCTGACGCATCTGTGAATGGCTGGAGCTCCGATGAGGAAAAGGCAGGGGGCCTGGAT
GATGAAGAGGAGGCCGAGCTCGTCCCCTCCGAGGTGCTCATGCACCAGGCCATCCACACC
ATCGAGTTCTGCCTGGGCTGCGTCTCCAACACCGCCTCCTACCTGCGCCTGTGGGCCCTG
AGCCTGGCCCACGCCCAGCTGTCCGAGGTTCTGTGGGCCATGGTGATGCGCATAGGCCTG
GGCCTGGGCCGGGAGGTGGGCGTGGCGGCTGTGGTGCTGGTCCCCATCTTTGCCGCCTTT
GCCGTGATGACCGTGGCTATCCTGCTGGTGATGGAGGGACTCTCAGCCTTCCTGCACGCC
CTGCGGCTGCACTGGGTGGAATTCCAGAACAAGTTCTACTCAGGCACGGGCTACAAGCTG
AGTCCCTTCACCTTCGCTGCCACAGATGACTAG
Protein Properties
Number of Residues 830
Molecular Weight 92969.0
Theoretical pI 7.13
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3 (T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3, isoform CRA_c)
MGSMFRSEEVALVQLFLPTAAAYTCVSRLGELGLVEFRDLNASVSAFQRRFVVDVRRCEE
LEKTFTFLQEEVRRAGLVLPPPKGRLPAPPPRDLLRIQEETERLAQELRDVRGNQQALRA
QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAP
ALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKITDCFH
CHVFPFLQQEEARLGALQQLQQQSQELQEVLGETERFLSQVLGRVLQLLPPGQVQVHKMK
AVYLALNQCSVSTTHKCLIAEAWCSVRDLPALQEALRDSSMEEGVSAVAHRIPCRDMPPT
LIRTNRFTASFQGIVDAYGVGRYQEVNPAPYTIITFPFLFAVMFGDVGHGLLMFLFALAM
VLAENRPAVKAAQNEIWQTFFRGRYLLLLMGLFSIYTGFIYNECFSRATSIFPSGWSVAA
MANQSGWSDAFLAQHTMLTLDPNVTGVFLGPYPFGIDPIWSLAANHLSFLNSFKMKMSVI
LGVVHMAFGVVLGVFNHVHFGQRHRLLLETLPELTFLLGLFGYLVFLVIYKWLCVWAARA
ASAPSILIHFINMFLFSHSPSNRLLYPRQEVVQATLVVLALAMVPILLLGTPLHLLHRHR
RRLRRRPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMHQAIHT
IEFCLGCVSNTASYLRLWALSLAHAQLSEVLWAMVMRIGLGLGREVGVAAVVLVPIFAAF
AVMTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFTFAATDD
GenBank ID Protein 17390298
UniProtKB/Swiss-Prot ID Q13488
UniProtKB/Swiss-Prot Entry Name Q8WVC5_HUMAN
PDB IDs Not Available
GenBank Gene ID BC018133
GeneCard ID Q8WVC5
GenAtlas ID TCIRG1
HGNC ID HGNC:11647
References
General References
  1. Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA: Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11. [PubMed:12477932 ]