Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09534
Secondary Accession Numbers
  • 15442
Name Putative uncharacterized protein ATP6V1E1
Synonyms
  1. SubName: cDNA FLJ51833, highly similar to Homo sapiens ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 (ATP6V1E1), transcript variant 2, mRNA
Gene Name ATP6V1E1
Protein Type Enzyme
Biological Properties
General Function Involved in proton-transporting ATPase activity, rotational mechanism
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
proton-transporting two-sector atpase complex, catalytic domain
macromolecular complex
protein complex
Function
proton-transporting atpase activity, rotational mechanism
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
transporter activity
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
atp synthesis coupled proton transport
atp biosynthetic process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 22pter-q11.2|22q11.1
SNPs ATP6V1E1
Gene Sequence
>615 bp
ATGGCTCTCAGCGATGCTGACGTGCAAAAGCAGGCAGAAGAAGAGTTCAACATAGAGAAA
GGTCGGCTTGTGCAAACCCAAAGACTAAAGATTATGGAATATTATGAGAAGAAAGAGAAA
CAGATTGAGCAGCAGAAGAAAATTCAGATGTCCAATTTGATGAATCAAGCGAGACTCAAA
GTCCTCAGAGCAAGAGATGACCTTATCACAGACCTACTAAATGAAGCAAAACAGAGACTC
AGCAAGGTGGTAAAAGATACAACCAGGTACCAAGTGCTGCTGGATGGACTGGTTCTCCAG
GGTTTGTACCAGTTGCTGGAGCCCCGAATGATTGTTCGTTGCAGGAAACAAGATTTCCCT
CTGGTAAAGGCTGCAGTGCAGAAGGCAATTCCTATGTACAAAATTGCCACCAAAAACGAT
GTTGATGTCCAAATTGACCAGGAGTCCTACCTGCCTGAAGACATAGCTGGTGGAGTTGAG
ATCTATAATGGAGATCGTAAAATAAAGGTTTCCAACACCCTGGAAAGCCGGCTGGATCTC
ATAGCCCAGCAGATGATGCCAGAAGTCCGGGGAGCCTTGTTTGGTGCAAATGCCAACAGG
AAGTTTTTGGACTAA
Protein Properties
Number of Residues 204
Molecular Weight 23587.2
Theoretical pI 9.47
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Putative uncharacterized protein ATP6V1E1
MALSDADVQKQAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLK
VLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFP
LVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDL
IAQQMMPEVRGALFGANANRKFLD
GenBank ID Protein 87159816
UniProtKB/Swiss-Prot ID P36543
UniProtKB/Swiss-Prot Entry Name A8MUE4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001039366.1
GeneCard ID ATP6V1E1
GenAtlas ID ATP6V1E1
HGNC ID HGNC:857
References
General References
  1. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]