Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09536
Secondary Accession Numbers
  • 15445
Name ATPase, H+ transporting, lysosomal accessory protein 1 (ATPase, H+ transporting, lysosomal accessory protein 1, isoform CRA_d) (cDNA FLJ78461, highly similar to Homo sapiens ATPase, H+ transporting, lysosomal accessory protein 1 (ATP6AP1), mRNA) (Fragment
Synonyms Not Available
Gene Name ATP6AP1
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
proton-transporting two-sector atpase complex
membrane
intrinsic to membrane
integral to membrane
cell
Function
hydrogen-transporting atpase activity, rotational mechanism
ion transporter activity
cation transporter activity
monovalent inorganic cation transporter activity
hydrogen ion transporter activity
hydrogen-transporting atp synthase activity, rotational mechanism
transporter activity
Process
cellular metabolism
cofactor metabolism
coenzyme metabolism
group transfer coenzyme metabolism
nucleoside phosphate metabolism
atp biosynthesis
atp synthesis coupled proton transport
physiological process
metabolism
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs A6ZKI4
Gene Sequence
>1413 bp
ATGATGGCGGCCATGGCGACGGCTCGAGTGCGGATGGGGCCGCGGTGCGCCCAGGCGCTC
TGGCGCATGCCGTGGCTGCCGGTGTTTTTGTCGTTGGCGGCGGCGGCGGCGGCGGCAGCG
GCGGAGCAGCAGGTCCCGCTGGTGCTGTGGTCGAGTGACCGGGACTTGTGGGCTCCTGCG
GCCGACACTCATGAAGGCCACATCACCAGCGACTTGCAGCTCTCTACCTACTTAGATCCC
GCCCTGGAGCTGGGTCCCAGGAATGTGCTGCTGTTCCTGCAGGACAAGCTGAGCATTGAG
GATTTCACAGCATATGGCGGTGTGTTTGGAAACAAGCAGGACAGCGCCTTTTCTAACCTA
GAGAATGCCCTGGACCTGGCCCCCTCCTCACTGGTGCTTCCTGCCGTCGACTGGTATGCA
GTCAGCACTCTGACCACTTACCTGCAGGAGAAGCTCGGGGCCAGCCCCTTGCATGTGGAC
CTGGCCACCCTGCGGGAGCTGAAGCTCAATGCCAGCCTCCCTGCTCTGCTGCTCATTCGC
CTGCCCTACACAGCCAGCTCTGGTCTGATGGCACCCAGGGAAGTCCTCACAGGCAACGAT
GAGGTCATCGGGCAGGTCCTGAGCACACTCAAGTCCGAAGATGTCCCATACACAGCGGCC
CTCACAGCGGTCCGCCCTTCCAGGGTGGCCCGTGATGTAGCCGTGGTGGCCGGAGGGCTA
GGTCGCCAGCTGCTACAAAAACAGCCAGTATCACCTGTGATCCATCCTCCTGTGAGTTAC
AATGACACCGCTCCCCGGATCCTGTTCTGGGCCCAAAACTTCTCTGTGGCGTACAAGGAC
CAGTGGGAGGACCTGACTCCCCTCACCTTTGGGGTGCAGGAACTCAACCTGACTGGCTCC
TTCTGGAATGACTCCTTTGCCAGGCTCTCACTGACCTATGAACGACTCTTTGGTACCACA
GTGACATTCAAGTTCATTCTGGCCAACCGCCTCTACCCAGTGTCTGCCCGGCACTGGTTT
ACCATGGAGCGCCTCGAAGTCCACAGCAATGGCTCCGTCGCCTACTTCAATGCTTCCCAG
GTCACAGGGCCCAGCATCTACTCCTTCCACTGCGAGTATGTCAGCAGCCTGAGCAAGAAG
GGTAGTCTCCTCGTGGCCCGCACGCAGCCCTCTCCCTGGCAGATGATGCTTCAGGACTTC
CAGATCCAGGCTTTCAACGTAATGGGGGAGCAGTTCTCCTACGCCAGCGACTGTGCCAGC
TTCTTCTCCCCCGGCATCTGGATGGGGCTGCTCACCTCCCTGTTCATGCTCTTCATCTTC
ACCTATGGCCTGCACATGATCCTCAGCCTCAAGACCATGGATCGCTTTGATGACCACAAG
GGCCCCACTATTTCTTTGACCCAGATTGTGTGA
Protein Properties
Number of Residues 470
Molecular Weight 52026.0
Theoretical pI 6.05
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>ATPase, H+ transporting, lysosomal accessory protein 1 (ATPase, H+ transporting, lysosomal accessory protein 1, isoform CRA_d) (cDNA FLJ78461, highly similar to Homo sapiens ATPase, H+ transporting, lysosomal accessory protein 1 (ATP6AP1), mRNA) (Fragment
MMAAMATARVRMGPRCAQALWRMPWLPVFLSLAAAAAAAAAEQQVPLVLWSSDRDLWAPA
ADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNL
ENALDLAPSSLVLPAVDWYAVSTLTTYLQEKLGASPLHVDLATLRELKLNASLPALLLIR
LPYTASSGLMAPREVLTGNDEVIGQVLSTLKSEDVPYTAALTAVRPSRVARDVAVVAGGL
GRQLLQKQPVSPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS
FWNDSFARLSLTYERLFGTTVTFKFILANRLYPVSARHWFTMERLEVHSNGSVAYFNASQ
VTGPSIYSFHCEYVSSLSKKGSLLVARTQPSPWQMMLQDFQIQAFNVMGEQFSYASDCAS
FFSPGIWMGLLTSLFMLFIFTYGLHMILSLKTMDRFDDHKGPTISLTQIV
GenBank ID Protein 158259927
UniProtKB/Swiss-Prot ID Q15904
UniProtKB/Swiss-Prot Entry Name A6ZKI4_HUMAN
PDB IDs Not Available
GenBank Gene ID AK289452
GeneCard ID A6ZKI4
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available