Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09962
Secondary Accession Numbers
  • 15894
Name Alpha-(1,3)-fucosyltransferase
Synonyms
  1. Fuc-TVI
  2. FucT-VI
  3. Fucosyltransferase 6
  4. Fucosyltransferase VI
  5. Galactoside 3-L-fucosyltransferase
Gene Name FUT6
Protein Type Enzyme
Biological Properties
General Function Involved in fucosyltransferase activity
Specific Function Enzyme involved in the biosynthesis of the E-Selectin ligand, sialyl-Lewis X. Catalyzes the transfer of fucose from GDP-beta-fucose to alpha-2,3 sialylated substrates.
Pathways
  • Glycosphingolipid biosynthesis - lacto and neolacto series
  • protein glycosylation
Reactions
GDP-L-fucose + beta-D-galactosyl-(1->3)-N-acetyl-D-glucosaminyl-R → Guanosine diphosphate + beta-D-galactosyl-(1->3)-(alpha-L-fucosyl-(1->4))-N-acetyl-beta-D-glucosaminyl-R details
GDP-L-fucose + Paragloboside → GDP + III3Fuc-nLc4Cer details
GDP-L-fucose + nLc6Cer → GDP + V3Fuc-nLc6Cer details
GDP-L-fucose + nLc8Cer → GDP + details
GDP-L-fucose + Sialyl-3-paragloboside → GDP + IV3NeuAc,III3Fuc-nLc4Cer details
GDP-L-fucose + VI2Fuc-nLc6 → GDP + details
GDP-L-fucose + IV2Fuc-nLc4Cer → GDP + III3,IV2Fuc-nLc4Cer details
GDP-L-fucose + V3Fuc-nLc6Cer → GDP + V3Fuc,III3Fuc-nLc6Cer details
GDP-L-fucose + → GDP + details
GDP-L-fucose + → GDP + details
GDP-L-fucose + → GDP + details
GDP-L-fucose + nLc6Cer → GDP + III3Fuc-nLc6Cer details
GO Classification
Biological Process
L-fucose catabolic process
protein glycosylation
Cellular Component
Golgi cisterna membrane
Golgi apparatus
integral to membrane
Component
membrane
cell part
Function
catalytic activity
transferase activity
transferase activity, transferring hexosyl groups
transferase activity, transferring glycosyl groups
fucosyltransferase activity
Molecular Function
3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity
alpha-(1->3)-fucosyltransferase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
protein amino acid glycosylation
Cellular Location
  1. Single-pass type II membrane protein
  2. Golgi apparatus
  3. Golgi stack membrane
Gene Properties
Chromosome Location 19
Locus 19p13.3
SNPs FUT6
Gene Sequence
>1080 bp
ATGGATCCCCTGGGCCCGGCCAAGCCACAGTGGTCGTGGCGCTGCTGTCTGACCACGCTG
CTGTTTCAGCTGCTGATGGCTGTGTGTTTCTTCTCCTATCTGCGTGTGTCTCAAGACGAT
CCCACTGTGTACCCTAATGGGTCCCGCTTCCCAGACAGCACAGGGACCCCCGCCCACTCC
ATCCCCCTGATCCTGCTGTGGACGTGGCCTTTTAACAAACCCATAGCTCTGCCCCGCTGC
TCAGAGATGGTGCCTGGCACGGCTGACTGCAACATCACTGCCGACCGCAAGGTGTATCCA
CAGGCAGACGCGGTCATCGTGCACCACCGAGAGGTCATGTACAACCCCAGTGCCCAGCTC
CCACGCTCCTCGAGGCGGCAGGGGCAGCGATGGATCTGGTTCAGCATGGAGTCCCCAAGC
CACTGCTGGCAGCTGAAAGCCATGGACGGATACTTCAATCTCACCATGTCCTACCGCAGC
GACTCCGACATCTTCACGCCCTACGGCTGGCTGGAGCCGTGGTCCGGCCAGCCTGCCCAC
CCACCGCTCAACCTCTCGGCCAAGACCGAGCTGGTGGCCTGGGCAGTGTCCAACTGGGGG
CCAAACTCCGCCAGGGTGCGCTACTACCAGAGCCTGCAGGCCCATCTCAAGGTGGACGTG
TACGGACGCTCCCACAAGCCCCTGCCCCAGGGAACCATGATGGAGACGCTGTCCCGGTAC
AAGTTCTATCTGGCCTTCGAGAACTCCTTGCACCCCGACTACATCACCGAGAAGCTGTGG
AGGAACGCCCTGGAGGCCTGGGCCGTGCCCGTGGTGCTGGGCCCCAGCAGAAGCAACTAC
GAGAGGTTCCTGCCGCCCGACGCCTTCATCCACGTGGACGACTTCCAGAGCCCCAAGGAC
CTGGCCCGGTACCTGCAGGAGCTGGACAAGGACCACGCCCGCTACCTGAGCTACTTTCGC
TGGCGGGAGACGCTGCGGCCTCGCTCCTTCAGCTGGGCACTCGCTTTCTGCAAGGCCTGC
TGGAAACTGCAGGAGGAATCCAGGTACCAGACACGCGGCATAGCGGCTTGGTTCACCTGA
Protein Properties
Number of Residues 359
Molecular Weight 41859.42
Theoretical pI 8.679
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Alpha-(1,3)-fucosyltransferase
MDPLGPAKPQWSWRCCLTTLLFQLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHS
IPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQL
PRSPRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAH
PPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRY
KFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKD
LARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT
GenBank ID Protein 4928266
UniProtKB/Swiss-Prot ID P51993
UniProtKB/Swiss-Prot Entry Name FUT6_HUMAN
PDB IDs Not Available
GenBank Gene ID AF131211
GeneCard ID FUT6
GenAtlas ID FUT6
HGNC ID HGNC:4017
References
General References
  1. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  2. Cameron HS, Szczepaniak D, Weston BW: Expression of human chromosome 19p alpha(1,3)-fucosyltransferase genes in normal tissues. Alternative splicing, polyadenylation, and isoforms. J Biol Chem. 1995 Aug 25;270(34):20112-22. [PubMed:7650030 ]
  3. Koszdin KL, Bowen BR: The cloning and expression of a human alpha-1,3 fucosyltransferase capable of forming the E-selectin ligand. Biochem Biophys Res Commun. 1992 Aug 31;187(1):152-7. [PubMed:1520296 ]
  4. Weston BW, Smith PL, Kelly RJ, Lowe JB: Molecular cloning of a fourth member of a human alpha (1,3)fucosyltransferase gene family. Multiple homologous sequences that determine expression of the Lewis x, sialyl Lewis x, and difucosyl sialyl Lewis x epitopes. J Biol Chem. 1992 Dec 5;267(34):24575-84. [PubMed:1339443 ]