You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10015
Secondary Accession Numbers
  • 15953
Name Carboxypeptidase B
Synonyms
  1. PASP
  2. Pancreas-specific protein
Gene Name CPB1
Protein Type Enzyme
Biological Properties
General Function Involved in metallocarboxypeptidase activity
Specific Function Preferential release of a C-terminal lysine or arginine amino acid
Pathways Not Available
Reactions Not Available
GO Classification
Function
exopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
metallocarboxypeptidase activity
carboxypeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:3
Locus 3q24
SNPs CPB1
Gene Sequence
>1254 bp
ATGTTGGCACTCTTGGTTCTGGTGACTGTGGCCCTGGCATCTGCTCATCATGGTGGTGAG
CACTTTGAAGGCGAGAAGGTGTTCCGTGTTAACGTTGAAGATGAAAATCACATTAACATA
ATCCGCGAGTTGGCCAGCACGACCCAGATTGACTTCTGGAAGCCAGATTCTGTCACACAA
ATCAAACCTCACAGTACAGTTGACTTCCGTGTTAAAGCAGAAGATACTGTCACTGTGGAG
AATGTTCTAAAGCAGAATGAACTACAATACAAGGTACTGATAAGCAACCTGAGAAATGTG
GTGGAGGCTCAGTTTGATAGCCGGGTTCGTGCAACAGGACACAGTTATGAGAAGTACAAC
AAGTGGGAAACGATAGAGGCTTGGACTCAACAAGTCGCCACTGAGAATCCAGCCCTCATC
TCTCGCAGTGTTATCGGAACCACATTTGAGGGACGCGCTATTTACCTCCTGAAGGTTGGC
AAAGCTGGACAAAATAAGCCTGCCATTTTCATGGACTGTGGTTTCCATGCCAGAGAGTGG
ATTTCTCCTGCATTCTGCCAGTGGTTTGTAAGAGAGGCTGTTCGTACCTATGGACGTGAG
ATCCAAGTGACAGAGCTTCTCAACAAGTTAGACTTTTATGTCCTGCCTGTGCTCAATATT
GATGGCTACATCTACACCTGGACCAAGAGCCGATTTTGGAGAAAGACTCGCTCCACCCAT
ACTGGATCTAGCTGCATTGGCACAGACCCCAACAGAAATTTTGATGCTGGTTGGTGTGAA
ATTGGAGCCTCTCGAAACCCCTGTGATGAAACTTACTGTGGACCTGCCGCAGAGTCTGAA
AAGGAGACCAAGGCCCTGGCTGATTTCATCCGCAACAAACTCTCTTCCATCAAGGCATAT
CTGACAATCCACTCGTACTCCCAAATGATGATCTACCCTTACTCATATGCTTACAAACTC
GGTGAGAACAATGCTGAGTTGAATGCCCTGGCTAAAGCTACTGTGAAAGAACTTGCCTCA
CTGCACGGCACCAAGTACACATATGGCCCGGGAGCTACAACAATCTATCCTGCTGCTGGG
GGCTCTGACGACTGGGCTTATGACCAAGGAATCAGATATTCCTTCACCTTTGAACTTCGA
GATACAGGCAGATATGGCTTTCTCCTTCCAGAATCCCAGATCCGGGCTACCTGCGAGGAG
ACCTTCCTGGCAATCAAGTATGTTGCCAGCTACGTCCTGGAACACCTGTACTAG
Protein Properties
Number of Residues 417
Molecular Weight 47367.1
Theoretical pI 6.59
Pfam Domain Function
Signals
  • 1-15
Transmembrane Regions
  • None
Protein Sequence
>Carboxypeptidase B
MLALLVLVTVALASAHHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQ
IKPHSTVDFRVKAEDTVTVENVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHSYEKYN
KWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVGKAGQNKPAIFMDCGFHAREW
ISPAFCQWFVREAVRTYGREIQVTELLDKLDFYVLPVLNIDGYIYTWTKSRFWRKTRSTH
TGSSCIGTDPNRNFDAGWCEIGASRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAY
LTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAG
GSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAIKYVASYVLEHLY
GenBank ID Protein 2960072
UniProtKB/Swiss-Prot ID P15086
UniProtKB/Swiss-Prot Entry Name CBPB1_HUMAN
PDB IDs
GenBank Gene ID AJ224866
GeneCard ID CPB1
GenAtlas ID CPB1
HGNC ID HGNC:2299
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Pascual R, Burgos FJ, Salva M, Soriano F, Mendez E, Aviles FX: Purification and properties of five different forms of human procarboxypeptidases. Eur J Biochem. 1989 Feb 15;179(3):609-16. [PubMed:2920728 ]
  3. Yamamoto KK, Pousette A, Chow P, Wilson H, el Shami S, French CK: Isolation of a cDNA encoding a human serum marker for acute pancreatitis. Identification of pancreas-specific protein as pancreatic procarboxypeptidase B. J Biol Chem. 1992 Feb 5;267(4):2575-81. [PubMed:1370825 ]
  4. Aloy P, Catasus L, Villegas V, Reverter D, Vendrell J, Aviles FX: Comparative analysis of the sequences and three-dimensional models of human procarboxypeptidases A1, A2 and B. Biol Chem. 1998 Feb;379(2):149-55. [PubMed:9524066 ]
  5. Barbosa Pereira PJ, Segura-Martin S, Oliva B, Ferrer-Orta C, Aviles FX, Coll M, Gomis-Ruth FX, Vendrell J: Human procarboxypeptidase B: three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI). J Mol Biol. 2002 Aug 16;321(3):537-47. [PubMed:12162965 ]