Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10017
Secondary Accession Numbers
  • 15955
Name Carboxypeptidase D
Synonyms
  1. Metallocarboxypeptidase D
  2. gp180
Gene Name CPD
Protein Type Enzyme
Biological Properties
General Function Involved in carboxypeptidase activity
Specific Function Releases C-terminal Arg and Lys from polypeptides
Pathways Not Available
Reactions Not Available
GO Classification
Function
exopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
serine-type carboxypeptidase activity
metallocarboxypeptidase activity
carboxypeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 17q11.2
SNPs CPD
Gene Sequence
>4143 bp
ATGGCGAGCGGCCGGGACGAGCGGCCGCCTTGGCGGCTAGGGCGGCTCCTGTTGCTCATG
TGCCTGCTGCTGCTGGGGAGCTCGGCCCGGGCGGCTCACATCAAGGAGGCGGAGGCGACT
ACCACAACTACGAGCGCGGGCGCCGAGGCGGCCGAGGGCCAGTTCGACCGCTACTACCAC
GAAGAGGAGTTGGAGTCGGCGCTGAGGGAGGCGGCGGCCGCGGGCCTCCCCGGCCTGGCC
CGCCTCTTTAGCATCGGCCGCTCGGTGGAAGGCCGGCCGCTGTGGGTGCTTCGCCTCACC
GCAGGCCTGGGGTCGCTAATCCCTGAGGGCGACGCGGGGCCTGACGCTGCCGGGCCCGAC
GCTGCGGGGCCGCTGCTGCCCGGCCGGCCCCAGGTGAAGCTGGTGGGCAACATGCATGGC
GACGAGACCGTGTCGCGCCAGGTGTTGATCTACTTGGCCCGCGAGCTGGCGGCCGGCTAC
CGCCGCGGGGACCCGCGCCTGGTCCGCCTGCTCAACACCACCGACGTGTACCTGCTGCCC
AGCCTCAACCCCGATGGCTTCGAGCGTGCCCGCGAGGGCGACTGTGGCTTCGGCGACGGC
GGCCCGTCCGGGGCCAGCGGCCGCGACAATAGTCGCGGCCGCGACCTCAACCGAAGCTTT
CCCGACCAGTTTAGCACCGGCGAACCCCCCGCCCTGGACGAGGTGCCCGAGGTGCGCGCC
CTCATCGAGTGGATCCGCAGGAACAAGTTTGTGCTTTCTGGAAATCTGCATGGTGGCTCA
GTGGTAGCAAGCTATCCTTTTGATGATTCTCCAGAACATAAGGCCACTGGAATCTATAGC
AAAACCTCAGATGATGAAGTATTTAAATACTTGGCAAAAGCTTATGCTTCAAACCACCCC
ATAATGAAAACTGGTGAGCCTCATTGTCCAGGAGATGAAGACGAGACTTTCAAAGATGGA
ATCACAAACGGCGCACATTGGTATGATGTGGAAGGTGGTATGCAAGATTACAATTATGTG
TGGGCCAACTGTTTTGAGATCACATTAGAACTGTCTTGTTGCAAGTACCCACCTGCTTCA
CAGCTTCGACAGGAATGGGAGAACAATCGTGAGTCTTTGATCACATTGATTGAAAAGGTT
CACATTGGAGTGAAAGGATTTGTTAAAGATTCCATAACAGGATCTGGGTTAGAGAATGCA
ACCATCTCAGTGGCTGGTATTAATCATAATATCACAACAGGCAGATTTGGTGATTTCTAC
CGATTACTTGTTCCTGGAACTTACAACCTTACAGTAGTTTTAACTGGGTATATGCCATTG
ACTGTTACTAATGTAGTGGTGAAAGAAGGACCAGCCACAGGGGTGGATTTTTCTCTTAGG
CCAACTGTAACTTCAGTAATCCCTGACACGACAGAGGCTGTATCAACTGCTAGCACAGTT
GCTATACCTAATATTCTTTCTGGAACATCATCCTCCTACCAGCCAATTCAGCCAAAGGAC
TTTCACCACCACAATTTCCCTGATATGGAAATCTTCTTGAGAAGGTTTGCCAATGAATAT
CCTAACATTACCCGGCTTTATTCCTTGGGAAAATCAGTAGAGTCAAGAGAACTTTATGTG
ATGGAGATATCTGATAATCCGGGTGTCCATGAACCAGGTGAACCAGAATTTAAGTACATT
GGAAATATGCATGGAAATGAAGTGGTTGGAAGAGAACTGCTGTTGAACCTCATAGAATAC
CTTTGTAAGAACTTTGGAACAGACCCTGAAGTCACAGATTTGGTTCATAACACTAGAATT
CACCTTATGCCATCCATGAATCCTGATGGGTATGAAAAGTCCCAGGAAGGAGATTCAATA
AGTGTAATTGGCAGAAACAACAGCAACAACTTTGACCTGAACCGAAATTTCCCAGACCAG
TTTGTTCAGATCACAGATCCTACGCAACCAGAAACTATTGCTGTAATGAGCTGGATGAAG
TCCTATCCATTTGTACTTTCAGCAAACCTGCATGGAGGTTCTTTGGTGGTTAACTACCCT
TTTGATGATGATGAACAAGGACTTGCCACATATAGTAAATCACCAGATGATGCTGTGTTC
CAACAAATAGCACTTTCTTATTCCAAGGAAAATTCCCAGATGTTTCAAGGTAGACCTTGC
AAGAATATGTATCCTAATGAATATTTTCCTCATGGAATAACAAATGGAGCTAGTTGGTAT
AATGTGCCAGGAGGAATGCAGGACTGGAACTATTTACAAACAAATTGCTTTGAAGTGACT
ATTGAACTAGGTTGTGTGAAATATCCACTTGAGAAAGAGCTGCCAAACTTTTGGGAACAG
AATCGAAGATCACTAATCCAGTTTATGAAACAGGTTCATCAGGGCGTCAGAGGATTTGTT
CTAGATGCCACAGATGGCAGGGGTATATTAAATGCCACCATTAGTGTTGCTGAGATTAAT
CACCCAGTGACTACTTACAAAACTGGAGATTACTGGCGTCTCTTGGTTCCAGGAACTTAT
AAAATCACAGCATCTGCTCGAGGGTATAATCCAGTTACCAAGAATGTGACTGTCAAGAGT
GAAGGCGCTATTCAGGTCAACTTCACACTTGTTCGATCCTCAACAGATTCAAACAATGAA
TCAAAGAAAGGAAAAGGGGCTAGCAGCAGCACCAATGATGCCAGTGATCCAACTACTAAA
GAGTTTGAAACTTTAATTAAAGACCTTTCAGCGGAGAATGGTTTGGAAAGCCTCATGTTA
CGCTCCTCCTCAAATCTGGCTCTGGCTCTTTATCGATACCATTCCTACAAAGACTTATCA
GAGTTTCTGAGAGGACTTGTAATGAACTATCCACATATTACAAATCTTACCAATTTGGGA
CAGAGCACTGAATATCGTCACATTTGGTCCCTTGAAATCTCCAATAAGCCCAATGTATCT
GAGCCTGAAGAACCAAAGATTCGTTTTGTTGCTGGTATCCATGGAAATGCGCCAGTTGGA
ACTGAACTGCTTTTGGCTCTGGCAGAATTTCTCTGCCTGAACTACAAAAAGAACCCAGCT
GTTACCCAATTGGTTGACAGGACTAGGATTGTGATTGTCCCTTCTCTAAATCCAGATGGG
CGAGAGAGAGCTCAAGAGAAAGACTGTACTTCAAAAATAGGACAAACAAATGCTCGTGGC
AAAGATTTGGATACAGACTTCACAAATAATGCCTCCCAACCTGAGACCAAAGCCATCATT
GAAAATTTGATTCAAAAACAGGACTTTAGTCTTTCTGTTGCCTTAGATGGTGGTTCCATG
CTGGTCACATATCCTTATGACAAGCCAGTACAGACAGTGGAAAATAAAGAGACTCTGAAG
CATTTGGCATCTCTTTATGCAAATAATCATCCATCCATGCACATGGGTCAGCCCAGTTGC
CCAAATAAATCAGATGAGAATATTCCAGGAGGAGTAATGCGTGGAGCAGAATGGCATAGT
CACCTGGGCAGCATGAAGGATTATAGTGTCACCTATGGCCATTGTCCGGAAATCACAGTA
TACACAAGCTGCTGTTACTTTCCTAGTGCTGCACGACTCCCTTCCTTGTGGGCAGACAAT
AAGAGATCTCTTCTTAGTATGTTAGTGGAGGTTCACAAGGGAGTTCATGGATTTGTTAAA
GATAAGACTGGAAAGCCAATCTCTAAAGCAGTCATTGTACTTAATGAAGGAATAAAGGTA
CAAACAAAAGAGGGAGGTTATTTCCATGTACTCTTAGCGCCAGGTGTCCATAACATTATT
GCCATCGCTGATGGGTACCAGCAACAACATTCACAGGTCTTTGTGCATCATGATGCAGCT
AGTTCTGTGGTGATAGTCTTTGACACAGATAACCGGATATTTGGTTTGCCAAGGGAGCTT
GTGGTAACTGTATCAGGTGCTACTATGTCGGCATTGATCCTAACAGCTTGCATTATTTGG
TGCATCTGCTCAATCAAGTCTAATAGACACAAGGATGGCTTTCATCGGCTCAGGCAGCAT
CATGATGAGTATGAAGATGAAATTCGCATGATGTCTACCGGCTCCAAGAAGTCCCTCCTA
AGCCATGAGTTCCAGGATGAAACAGACACTGAAGAGGAAACATTATATTCTAGCAAACAT
TGA
Protein Properties
Number of Residues 1380
Molecular Weight 152929.9
Theoretical pI 5.95
Pfam Domain Function
Signals
  • 1-31
Transmembrane Regions
  • 1300-1320
Protein Sequence
>Carboxypeptidase D
MASGRDERPPWRLGRLLLLMCLLLLGSSARAAHIKKAEATTTTTSAGAEAAEGQFDRYYH
EEELESALREAAAAGLPGLARLFSIGRSVEGRPLWVLRLTAGLGSLIPEGDAGPDAAGPD
AAGPLLPGRPQVKLVGNMHGDETVSRQVLIYLARELAAGYRRGDPRLVRLLNTTDVYLLP
SLNPDGFERAREGDCGFGDGGPSGASGRDNSRGRDLNRSFPDQFSTGEPPALDEVPEVRA
LIEWIRRNKFVLSGNLHGGSVVASYPFDDSPEHKATGIYSKTSDDEVFKYLAKAYASNHP
IMKTGEPHCPGDEDETFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPAS
QLRQEWENNRESLITLIEKVHIGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFY
RLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRPTVTSVIPDTTEAVSTASTV
AIPNILSGTSSSYQPIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYV
MEISDNPGVHEPGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVHNTRI
HLMPSMNPDGYEKSQEGDSISVIGRNNSNNFDLNRNFPDQFVQITDPTQPETIAVMSWMK
SYPFVLSANLHGGSLVVNYPFDDDEQGLATYSKSPDDAVFQQIALSYSKENSQMFQGRPC
KNMYPNEYFPHGITNGASWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPLEKELPNFWEQ
NRRSLIQFMKQVHQGVRGFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTY
KITASARGYNPVTKNVTVKSEGAIQVNFTLVRSSTDSNNESKKGKGASSSTNDASDPTTK
EFETLIKDLSAENGLESLMLRSSSNLALALYRYHSYKDLSEFLRGLVMNYPHITNLTNLG
QSTEYRHIWSLEISNKPNVSEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPA
VTQLVDRTRIVIVPSLNPDGRERAQEKDCTSKIGQTNARGKDLDTDFTNNASQPETKAII
ENLIQKQDFSLSVALDGGSMLVTYPYDKPVQTVENKETLKHLASLYANNHPSMHMGQPSC
PNKSDENIPGGVMRGAEWHSHLGSMKDYSVTYGHCPEITVYTSCCYFPSAARLPSLWADN
KRSLLSMLVEVHKGVHGFVKDKTGKPISKAVIVLNEGIKVQTKEGGYFHVLLAPGVHNII
AIADGYQQQHSQVFVHHDAASSVVIVFDTDNRIFGLPRELVVTVSGATMSALILTACIIW
CICSIKSNRHKDGFHRLRQHHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH
GenBank ID Protein 28374245
UniProtKB/Swiss-Prot ID O75976
UniProtKB/Swiss-Prot Entry Name CBPD_HUMAN
PDB IDs Not Available
GenBank Gene ID BC045549
GeneCard ID CPD
GenAtlas ID CPD
HGNC ID HGNC:2301
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  6. Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. [PubMed:12754519 ]
  7. Ishikawa T, Murakami K, Kido Y, Ohnishi S, Yazaki Y, Harada F, Kuroki K: Cloning, functional expression, and chromosomal localization of the human and mouse gp180-carboxypeptidase D-like enzyme. Gene. 1998 Jul 30;215(2):361-70. [PubMed:9714835 ]
  8. Tan F, Rehli M, Krause SW, Skidgel RA: Sequence of human carboxypeptidase D reveals it to be a member of the regulatory carboxypeptidase family with three tandem active site domains. Biochem J. 1997 Oct 1;327 ( Pt 1):81-7. [PubMed:9355738 ]
  9. McGwire GB, Tan F, Michel B, Rehli M, Skidgel RA: Identification of a membrane-bound carboxypeptidase as the mammalian homolog of duck gp180, a hepatitis B virus-binding protein. Life Sci. 1997;60(10):715-24. [PubMed:9064476 ]
  10. Kalinina EV, Fricker LD: Palmitoylation of carboxypeptidase D. Implications for intracellular trafficking. J Biol Chem. 2003 Mar 14;278(11):9244-9. [PubMed:12643288 ]