Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10022
Secondary Accession Numbers
  • 15963
Name Putative hydroxypyruvate isomerase
Synonyms
  1. Endothelial cell apoptosis protein E-CE1
Gene Name HYI
Protein Type Enzyme
Biological Properties
General Function Carbohydrate transport and metabolism
Specific Function Catalyzes the reversible isomerization between hydroxypyruvate and 2-hydroxy-3-oxopropanoate (also termed tartronate semialdehyde) (By similarity).
Pathways
  • Glyoxylate and dicarboxylate metabolism
Reactions
Hydroxypyruvic acid → Tartronate semialdehyde details
GO Classification
Molecular Function
hydroxypyruvate isomerase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p34.2
SNPs HYI
Gene Sequence
>834 bp
ATGGCGCCGCTGCGCTTCTCCGCCAATCTGTCCTGGCTATTCCCCGAGCTCTCCGGCCTC
CCCGCGCGGGTGCGGGCCGCGGGCAGCTCGGGCTTCGAGGCCGTCGAGGTGGCCTGGCCG
TACGCGGAGACGCCTGAGGCGCTGGCGCGCGCCGCGCGAGAAGCGGGGCTGCGGCTTGTA
CTGATCAACACGCCCCCGGGAGACCAAGAGAAGGGGGAAATGGGGCTGGGGGCCGTCCCC
GGGAGACAGGCGGCCTTCCGAGAGGGACTGGAGCAGGCCGTGCGGTATGCCAAAGCCCTG
GGCTGTCCCAGGATCCACCTGATGGCTGGCCGAGTACCCCAGGGAGCTGATCGAATAGCA
GTCAAGGCTGAGATGGAGGCCGTTTTTCTGGAGAACCTGAGGCATGCAGCTGGGGTTTTG
GCTCAGGAGGACCTCGTGGGACTGCTGGAGCCCATCAACACCCGCATCACTGACCCCCAG
TACTTCCTGGACACGCCCCAGCAGGCGGCAGCCATCTTACAGAAGGTAGGAAGACCCAAC
CTCCAATTACAAATGGACATATTCCACTGGCAGATCATGGATGGGAACCTGACAGGAAAC
ATCCGGGAGTTCCTGCCCATTGTTGGGCATGTGCAGGTGGCACAGGTCCCAGGCCGAGGG
GAGCCCAGCAGCCCCGGAGAGCTGAATTTCCCCTATCTGTTTCAACTGCTGGAAGATGAA
GGCTACAAAGGCTTCGTGGGCTGTGAGTATCAGCCTCGAGGAGACACAGTAGAGGGCTTG
AGTTGGCTACGTTCATACTGGGATAGGCGGGGCCACCCAGAGGCTGGCCAGTGA
Protein Properties
Number of Residues 277
Molecular Weight 30405.4
Theoretical pI 5.496
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Putative hydroxypyruvate isomerase
MAPLRFSANLSWLFPELSGLPARVRAAGSSGFEAVEVAWPYAETPEALARAAREAGLRLV
LINTPPGDQEKGEMGLGAVPGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIA
VKAEMEAVFLENLRHAAGVLAQEDLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPN
LQLQMDIFHWQIMDGNLTGNIREFLPIVGHVQVAQVPGRGEPSSPGELNFPYLFQLLEDE
GYKGFVGCEYQPRGDTVEGLSWLRSYWDRRGHPEAGQ
GenBank ID Protein 300068962
UniProtKB/Swiss-Prot ID Q5T013
UniProtKB/Swiss-Prot Entry Name HYI_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001190880.1
GeneCard ID HYI
GenAtlas ID HYI
HGNC ID HGNC:26948
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]