You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10105
Secondary Accession Numbers
  • 16056
Name Carboxylesterase 5A
Synonyms
  1. Carboxylesterase-like urinary excreted protein homolog
  2. Cauxin
Gene Name CES5A
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs (By similarity).
Pathways Not Available
Reactions
A carboxylic ester + Water → an alcohol + a carboxylate details
GO Classification
Cellular Component
extracellular region
Molecular Function
carboxylesterase activity
retinyl-palmitate esterase activity
methyl indole-3-acetate esterase activity
methyl jasmonate esterase activity
methyl salicylate esterase activity
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location 16
Locus 16q12.2
SNPs CES7
Gene Sequence
>1728 bp
ATGAGTGGGAATTGGGTGCACCCAGGCCAGATCCTAATTTGGGCTATCTGGGTCCTTGCA
GCCCCCACCAAAGGGCCTTCTGCTGAAGGGCCACAGAGGAACACCAGGCTGGGATGGATT
CAGGGCAAGCAAGTCACTGTGCTGGGAAGCCCTGTGCCTGTGAACGTGTTCCTCGGAGTC
CCCTTTGCTGCTCCCCCGCTGGGATCCCTGCGATTTACGAACCCGCAGCCTGCATCGCCC
TGGGATAACTTGCGAGAAGCCACCTCCTACCCTAATTTGTGCCTCCAGAACTCAGAGTGG
CTGCTCTTAGATCAACATATGCTCAAGGTGCATTACCCGAAATTCGGAGTGTCAGAAGAC
TGCCTCTACCTGAACATCTATGCGCCTGCCCACGCCGATACAGGCTCCAAGCTCCCCGTC
TTGGTGTGGTTCCCAGGAGGTGCCTTCAAGACTGGCTCAGCCTCCATCTTTGATGGGTCC
GCCCTGGCTGCCTATGAGGACGTGCTGGTTGTGGTCGTCCAGTACCGGCTAGGAATATTT
GGTTTCTTCACCACATGGGATCAGCATGCTCCGGGGAACTGGGCCTTCAAGGACCAGGTG
GCTGCTCTGTCCTGGGTCCAGAAGAACATCGAGTTCTTCGGTGGGGACCCCAGCTCTGTG
ACCATCTTTGGCGAGTCCGCGGGAGCCATAAGTGTTTCTAGTCTTATACTGTCTCCCATG
GCCAAAGGCTTATTCCACAAAGCCATCATGGAGAGTGGGGTGGCCATCATCCCTTACCTG
GAGGCCCATGATTATGAGAAGAGTGAGGACCTGCAGGTGGTTGCACATTTCTGTGGTAAC
AATGCGTCAGACTCTGAGGCCCTGCTGAGGTGCCTGAGGACAAAACCCTCCAAGGAGCTG
CTGACCCTCAGCCAGAAAACAAAGTCTTTCACTCGAGTGGTTGATGGTGCTTTCTTTCCT
AATGAGCCTCTAGATCTATTGTCTCAGAAAGCATTTAAAGCAATTCCTTCCATCATCGGA
GTCAATAACCACGAGTGTGGCTTCCTGCTGCCTATGAAGGAGGCTCCTGAGATCCTCAGT
GGCTCCAACAAGTCCCTTGCCCTCCATCTGATACAAAACATCCTGCACATCCCGCCTCAG
TATTTGCACCTTGTGGCTAATGAATACTTCCATGACAAGCACTCCCTGACTGAAATCCGA
GACAGTCTTCTGGACTTGCTTGGAGATGTGTTCTTTGTGGTCCCTGCACTGATCACAGCT
CGATATCACAGAGATGCTGGTGCACCTGTCTACTTCTATGAGTTTCGGCACCGGCCTCAG
TGCTTTGAAGACACGAAGCCAGCTTTTGTCAAAGCCGACCACGCTGATGAAGTCCGCTTT
GTGTTCGGTGGTGCCTTCCTGAAGGGGGACATTGTTATGTTCGAAGGAGCCACGGAGGAG
GAGAAGTTACTGAGCCGGAAGATGATGAAATACTGGGCTACCTTTGCTCGAACCGGGAAT
CCTAATGGGAACGACCTGTCTCTGTGGCCAGCTTATAATCTGACTGAGCAGTACCTCCAG
CTGGACTTGAACATGAGCCTCGGACAGAGACTCAAAGAACCGCGGGTGGATTTTTGGACC
AGCACCATCCCCCTGATCCTGTCTGCCTCCGACATGCTCCACAGTCCTCTTTCTTCCTTA
ACTTTCCTCTCTCTCCTCCAGCCTTTCTTTTTCTTTTGTGCTCCTTGA
Protein Properties
Number of Residues 575
Molecular Weight 63925.82
Theoretical pI 6.442
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Carboxylesterase 7
MSGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSPVPVNVFLGV
PFAAPPLGSLRFTNPQPASPWDNLREATSYPNLCLQNSEWLLLDQHMLKVHYPKFGVSED
CLYLNIYAPAHADTGSKLPVLVWFPGGAFKTGSASIFDGSALAAYEDVLVVVVQYRLGIF
GFFTTWDQHAPGNWAFKDQVAALSWVQKNIEFFGGDPSSVTIFGESAGAISVSSLILSPM
AKGLFHKAIMESGVAIIPYLEAHDYEKSEDLQVVAHFCGNNASDSEALLRCLRTKPSKEL
LTLSQKTKSFTRVVDGAFFPNEPLDLLSQKAFKAIPSIIGVNNHECGFLLPMKEAPEILS
GSNKSLALHLIQNILHIPPQYLHLVANEYFHDKHSLTEIRDSLLDLLGDVFFVVPALITA
RYHRDAGAPVYFYEFRHRPQCFEDTKPAFVKADHADEVRFVFGGAFLKGDIVMFEGATEE
EKLLSRKMMKYWATFARTGNPNGNDLSLWPAYNLTEQYLQLDLNMSLGQRLKEPRVDFWT
STIPLILSASDMLHSPLSSLTFLSLLQPFFFFCAP
GenBank ID Protein 219521907
UniProtKB/Swiss-Prot ID Q6NT32
UniProtKB/Swiss-Prot Entry Name EST7_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001143685.1
GeneCard ID CES7
GenAtlas ID CES7
HGNC ID HGNC:26459
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]