You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10108
Secondary Accession Numbers
  • 16059
Name Peroxiredoxin-4
Synonyms
  1. AOE37-2
  2. Antioxidant enzyme AOE372
  3. Peroxiredoxin IV
  4. Prx-IV
  5. Thioredoxin peroxidase AO372
  6. Thioredoxin-dependent peroxide reductase A0372
Gene Name PRDX4
Protein Type Enzyme
Biological Properties
General Function Involved in antioxidant activity
Specific Function Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.
Pathways Not Available
Reactions
R'-SH + ROOH → R'-S-S-R' + Water + ROH details
GO Classification
Biological Process
I-kappaB phosphorylation
Cellular Component
mitochondrion
extracellular space
Function
peroxiredoxin activity
catalytic activity
antioxidant activity
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
oxidoreductase activity
Molecular Function
thioredoxin peroxidase activity
Process
cellular process
cellular homeostasis
cell redox homeostasis
Cellular Location
  1. Cytoplasm
  2. Secreted
Gene Properties
Chromosome Location X
Locus Xp22.11
SNPs PRDX4
Gene Sequence
>816 bp
ATGGAGGCGCTGCCGCTGCTAGCCGCGACAACTCCGGACCACGGCCGCCACCGAAGGCTG
CTTCTGCTGCCGCTACTGCTGTTCCTGCTGCCGGCTGGAGCTGTGCAGGGCTGGGAGACA
GAGGAGAGGCCCCGGACTCGCGAAGAGGAGTGCCACTTCTACGCGGGTGGACAAGTGTAC
CCGGGAGAGGCATCCCGGGTATCGGTCGCCGACCACTCCCTGCACCTAAGCAAAGCGAAG
ATTTCCAAGCCAGCGCCCTACTGGGAAGGAACAGCTGTGATCGATGGAGAATTTAAGGAG
CTGAAGTTAACTGATTATCGTGGGAAATACTTGGTTTTCTTCTTCTACCCACTTGATTTC
ACATTTGTGTGTCCAACTGAAATTATCGCTTTTGGCGACAGACTTGAAGAATTCAGATCT
ATAAATACTGAAGTGGTAGCATGCTCTGTTGATTCACAGTTTACCCATTTGGCCTGGATT
AATACCCCTCGAAGACAAGGAGGACTTGGGCCAATAAGGATTCCACTTCTTTCAGATTTG
ACCCATCAGATCTCAAAGGACTATGGTGTATACCTAGAGGACTCAGGCCACACTCTTAGA
GGTCTCTTCATTATTGATGACAAAGGAATCCTAAGACAAATTACTCTGAATGATCTTCCT
GTGGGTAGATCAGTGGATGAGACACTACGTTTGGTTCAAGCATTCCAGTACACTGACAAA
CACGGAGAAGTCTGCCCTGCTGGCTGGAAACCTGGTAGTGAAACAATAATCCCAGATCCA
GCTGGAAAGCTGAAGTATTTCGATAAACTGAATTGA
Protein Properties
Number of Residues 271
Molecular Weight 30539.6
Theoretical pI 6.286
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Peroxiredoxin-4
MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVY
PGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDF
TFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDL
THQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDK
HGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
GenBank ID Protein 13177646
UniProtKB/Swiss-Prot ID Q13162
UniProtKB/Swiss-Prot Entry Name PRDX4_HUMAN
PDB IDs
GenBank Gene ID BC003609
GeneCard ID PRDX4
GenAtlas ID PRDX4
HGNC ID HGNC:17169
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Xu G, Shin SB, Jaffrey SR: Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini. Proc Natl Acad Sci U S A. 2009 Nov 17;106(46):19310-5. doi: 10.1073/pnas.0908958106. Epub 2009 Nov 5. [PubMed:19892738 ]
  3. Wagner E, Luche S, Penna L, Chevallet M, Van Dorsselaer A, Leize-Wagner E, Rabilloud T: A method for detection of overoxidation of cysteines: peroxiredoxins are oxidized in vivo at the active-site cysteine during oxidative stress. Biochem J. 2002 Sep 15;366(Pt 3):777-85. [PubMed:12059788 ]
  4. Jin DY, Chae HZ, Rhee SG, Jeang KT: Regulatory role for a novel human thioredoxin peroxidase in NF-kappaB activation. J Biol Chem. 1997 Dec 5;272(49):30952-61. [PubMed:9388242 ]