Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10128
Secondary Accession Numbers
  • 16084
Name Ubiquitin carboxyl-terminal hydrolase 26
Synonyms
  1. Deubiquitinating enzyme 26
  2. Ubiquitin thiolesterase 26
  3. Ubiquitin-specific-processing protease 26
Gene Name USP26
Protein Type Enzyme
Biological Properties
General Function Involved in ubiquitin thiolesterase activity
Specific Function Involved in the ubiquitin-dependent proteolytic pathway in conjunction with the 26S proteasome. Deubiquinates the androgen receptor and regulates the androgen receptor signaling pathway
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
ubiquitin thiolesterase activity
thiolester hydrolase activity
Process
metabolic process
catabolic process
macromolecule catabolic process
cellular macromolecule catabolic process
modification-dependent macromolecule catabolic process
modification-dependent protein catabolic process
ubiquitin-dependent protein catabolic process
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs USP26
Gene Sequence
>2742 bp
ATGGCTGCCCTATTCCTACGTGGTTTTGTCCAAATAGGGAACTGCAAGACTGGGATATCT
AAGTCAAAAGAAGCATTCATTGAAGCAGTGGAAAGAAAGAAGAAAGATAGACTGGTGCTG
TATTTCAAAAGTGGAAAATATAGCACTTTTCGGCTAAGTGATAATATTCAAAATGTAGTC
CTTAAATCCTATAGAGGAAACCAAAATCACCTGCATTTAACTTTACAAAATAATAATGGC
TTGTTTATTGAAGGATTATCCTCCACAGATGCTGAACAATTGAAGATATTCTTGGACAGA
GTTCATCAAAACGAGGTTCAGCCACCTGTGAGACCTGGTAAGGGTGGGAGTGTCTTTTCT
AGCACAACACAGAAGGAAATCAACAAAACTTCATTCCACAAAGTTGATGAGAAATCAAGT
AGCAAATCTTTTGAGATAGCAAAAGGAAGTGGGACAGGTGTCCTTCAGAGGATGCCTTTG
CTTACATCAAAATTGACACTTACTTGCGGAGAGTTATCAGAAAATCAGCACAAGAAGAGG
AAAAGAATGCTCTCATCTAGCTCAGAGATGAATGAGGAATTCTTGAAAGAAAATAATTCT
GTAGAATACAAGAAATCCAAGGCAGATTGTTCGAGGTGTGTAAGCTATAATCGAGAGAAA
CAATTGAAGTTAAAAGAGTTAGAAGAGAATAAGAAATTGGAATGTGAATCTTCATGCATC
ATGAACGCCACTGGAAATCCTTACCTAGATGACATTGGTCTTCTCCAAGCTCTCACTGAG
AAAATGGTTTTGGTATTTCTGTTACAACAAGGGTATAGTGACGGTTACACAAAGTGGGAT
AAATTAAAACTATTTTTTGAATTATTTCCAGAGAAAATATGCCACGGCCTCCCCAATTTG
GGAAACACCTGTTATATGAATGCAGTGTTACAGTCTCTACTTTCAATCCCATCGTTTGCT
GATGATTTACTTAATCAGAGTTTCCCATGGGGTAAAATTCCCCTTAATGCTCTTACCATG
TGCTTGGCACGGCTACTTTTTTTTAAAGATACCTATAATATAGAAATCAAGGAGATGTTA
CTCTTGAATCTTAAAAAGGCCATTTCAGCAGCTGCAGAGATATTCCATGGCAATGCACAG
AACGATGCTCATGAGTTTTTAGCTCACTGTTTAGATCAACTGAAAGATAACATGGAAAAA
CTCAACACAATTTGGAAGCCTAAAAGTGAATTTGGGGAAGATAATTTTCCTAAACAGGTT
TTTGCTGATGATCCTGACACCAGTGGGTTTTCTTGCCCTGTCATTACTAATTTTGAGTTA
GAGTTGTTGCACTCCATTGCTTGTAAAGCTTGTGGTCAGGTTATTCTCAAGACAGAACTG
AATAATTACCTCTCCATCAACCTTCCCCAAAGAATAAAAGCACATCCTTCATCTATTCAG
TCTACTTTTGATCTTTTTTTTGGAGCAGAAGAGCTTGAGTATAAATGTGCAAAATGTGAG
CACAAGACTTCCGTTGGAGTGCACTCATTCAGTAGGCTACCTAGAATCCTTATTGTTCAC
CTCAAACGCTATAGCTTGAATGAGTTTTGTGCATTAAAGAAGAATGACCAGGAAGTCATC
ATTTCCAAATATTTAAAGGTGTCTTCTCATTGCAATGAAGGCACCAGACCACCTCTTCCC
TTGAGTGAGGATGGAGAAATTACAGATTTCCAATTATTAAAAGTTATTCGAAAGATGACT
TCTGGAAACATCAGTGTATCATGGCCTGCAACAAAGGAATCCAAAGATATCCTGGCTCCA
CACATTGGATCAGATAAGGAGTCTGAACAAAAAAAAGGCCAGACAGTCTTTAAAGGGGCA
AGCAGAAGACAGCAGCAAAAGTACCTTGGAAAAAATTCTAAACCAAATGAGCTAGAATCT
GTATACTCAGGAGATCGAGCATTCATTGAAAAAGAACCGTTAGCTCACTTAATGACGTAT
CTGGAAGATACCTCACTTTGTCAGTTCCACAAAGCTGGAGGTAAACCTGCCAGCAGCCCA
GGCACACCTCTCTCAAAAGTTGACTTTCAAACAGTGCCCGAAAATCCAAAACGAAAGAAA
TATGTGAAAACCAGTAAGTTTGTAGCTTTTGATAGGATTATCAATCCTACTAAAGATTTG
TATGAAGATAAAAATATCAGAATTCCAGAAAGATTCCAAAAAGTGTCTGAACAGACTCAG
CAGTGTGACGGTATGAGAATCTGTGAACAAGCCCCTCAGCAGGCACTGCCTCAAAGCTTT
CCAAAGCCAGGCACCCAGGGGCACACAAAGAACCTCCTAAGACCTACAAAATTAAATCTA
CAGAAGTCTAACAGGAATTCCCTACTTGCACTGGGTTCCAATAAGAATCCAAGAAACAAA
GACATTTTAGATAAGATAAAATCTAAAGCCAAGGAAACAAAAAGAAATGATGATAAGGGA
GATCATACCTACCGGCTCATTAGTGTTGTCAGCCATCTTGGGAAGACTCTAAAGTCAGGC
CATTATATCTGTGATGCCTATGACTTTGAGAAACAGATCTGGTTCACTTACGATGATATG
CGGGTGTTAGGTATCCAGGAGGCCCAGATGCAGGAGGATAGGCGTTGCACTGGGTACATC
TTCTTTTACATGCATAATGAGATCTTTGAAGAGATGTTGAAAAGAGAAGAGAATGCCCAG
CTTAATAGCAAGGAGGTAGAGGAGACCCTTCAGAAGGAATAA
Protein Properties
Number of Residues 913
Molecular Weight 104046.2
Theoretical pI 8.96
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ubiquitin carboxyl-terminal hydrolase 26
MAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVV
LKSYRGNQNHLHLTLQNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPVRPGKGGSVFS
STTQKEINKTSFHKVDEKSSSKSFEIAKGSGTGVLQRMPLLTSKLTLTCGELSENQHKKR
KRMLSSSSEMNEEFLKENNSVEYKKSKADCSRCVSYNREKQLKLKELEENKKLECESSCI
MNATGNPYLDDIGLLQALTEKMVLVFLLQQGYSDGYTKWDKLKLFFELFPEKICHGLPNL
GNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLFFKDTYNIEIKEML
LLNLKKAISAAAEIFHGNAQNDAHEFLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPKQV
FADDPDTSGFSCPVITNFELELLHSIACKACGQVILKTELNNYLSINLPQRIKAHPSSIQ
STFDLFFGAEELEYKCAKCEHKTSVGVHSFSRLPRILIVHLKRYSLNEFCALKKNDQEVI
ISKYLKVSSHCNEGTRPPLPLSEDGEITDFQLLKVIRKMTSGNISVSWPATKESKDILAP
HIGSDKESEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEPLAHLMTY
LEDTSLCQFHKAGGKPASSPGTPLSKVDFQTVPENPKRKKYVKTSKFVAFDRIINPTKDL
YEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRPTKLNL
QKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLKSG
HYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRRCTGYIFFYMHNEIFEEMLKREENAQ
LNSKEVEETLQKE
GenBank ID Protein 13603869
UniProtKB/Swiss-Prot ID Q9BXU7
UniProtKB/Swiss-Prot Entry Name UBP26_HUMAN
PDB IDs Not Available
GenBank Gene ID AF285593
GeneCard ID USP26
GenAtlas ID USP26
HGNC ID HGNC:13485
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  3. Wang PJ, McCarrey JR, Yang F, Page DC: An abundance of X-linked genes expressed in spermatogonia. Nat Genet. 2001 Apr;27(4):422-6. [PubMed:11279525 ]
  4. Dirac AM, Bernards R: The deubiquitinating enzyme USP26 is a regulator of androgen receptor signaling. Mol Cancer Res. 2010 Jun;8(6):844-54. doi: 10.1158/1541-7786.MCR-09-0424. Epub 2010 May 25. [PubMed:20501646 ]
  5. Paduch DA, Mielnik A, Schlegel PN: Novel mutations in testis-specific ubiquitin protease 26 gene may cause male infertility and hypogonadism. Reprod Biomed Online. 2005 Jun;10(6):747-54. [PubMed:15970005 ]
  6. Christensen GL, Griffin J, Carrell DT: Sequence analysis of the X-linked USP26 gene in severe male factor infertility patients and fertile controls. Fertil Steril. 2008 Sep;90(3):851-2. doi: 10.1016/j.fertnstert.2007.06.096. Epub 2008 Apr 18. [PubMed:18377898 ]
  7. Ribarski I, Lehavi O, Yogev L, Hauser R, Bar-Shira Maymon B, Botchan A, Paz G, Yavetz H, Kleiman SE: USP26 gene variations in fertile and infertile men. Hum Reprod. 2009 Feb;24(2):477-84. doi: 10.1093/humrep/den374. Epub 2008 Oct 16. [PubMed:18927127 ]