Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10129
Secondary Accession Numbers
  • 16085
Name Ubiquitin carboxyl-terminal hydrolase
Synonyms Not Available
Gene Name USP42
Protein Type Enzyme
Biological Properties
General Function Involved in ubiquitin thiolesterase activity
Specific Function Ubiquitin C-terminal thioester + H(2)O = ubiquitin + a thiol
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
ubiquitin thiolesterase activity
thiolester hydrolase activity
Process
metabolic process
catabolic process
macromolecule catabolic process
cellular macromolecule catabolic process
modification-dependent macromolecule catabolic process
modification-dependent protein catabolic process
ubiquitin-dependent protein catabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:7
Locus 7p22.1
SNPs USP42
Gene Sequence
>3951 bp
ATGACCATAGTTGACAAAGCTTCTGAATCTTCAGACCCATCAGCCTATCAGAATCAGCCT
GGCAGCTCCGAGGCAGTCTCACCTGGAGACATGGATGCAGGTTCTGCCAGCTGGGGTGCT
GTGTCTTCATTGAATGATGTGTCAAATCACACACTTTCTTTAGGACCAGTACCTGGTGCT
GTAGTTTATTCGAGTTCATCTGTACCTGATAAATCAAAACCATCACCACAAAAGGATCAA
GCCCTAGGTGATGGCATCGCTCCTCCACAGAAAGTTCTTTTCCCATCTGAGAAGATTTGT
CTTAAGTGGCAACAAACTCATAGAGTTGGAGCTGGGCTCCAGAATTTGGGCAATACCTGT
TTTGCCAATGCAGCACTGCAGTGTTTAACCTACACACCACCTCTTGCCAATTACATGCTA
TCACATGAACACTCCAAAACATGTCATGCAGAAGGCTTTTGTATGATGTGTACAATGCAA
GCACATATTACCCAGGCACTCAGTAATCCTGGGGACGTTATTAAACCAATGTTTGTCATC
AATGAGATGCGGCGTATAGCTAGGCACTTCCGTTTTGGAAACCAAGAAGATGCCCATGAA
TTCCTTCAATACACTGTTGATGCTATGCAGAAAGCATGCTTGAATGGCAGCAATAAATTA
GACAGACACACCCAGGCCACCACTCTTGTTTGTCAGATATTTGGAGGATACCTAAGATCT
AGAGTCAAATGTTTAAATTGCAAGGGCGTTTCAGATACTTTTGATCCATATCTTGATATA
ACATTGGAGATAAAGGCTGCTCAGAGTGTCAACAAGGCATTGGAGCAGTTTGTGAAGCCG
GAACAGCTTGATGGAGAAAACTCGTACAAGTGCAGCAAGTGTAAAAAGATGGTTCCAGCT
TCAAAGAGGTTCACTATCCATAGATCCTCTAATGTTCTTACACTTTCTCTGAAACGTTTT
GCAAATTTTACCGGTGGAAAAATTGCTAAGGATGTGAAATACCCTGAGTATCTTGATATT
CGGCCATATATGTCTCAACCCAACGGAGAGCCAATTGTCTACGTCTTGTATGCAGTGCTG
GTCCACACTGGTTTTAATTGCCATGCTGGCCATTACTTCTGCTACATAAAAGCTAGCAAT
GGCCTCTGGTATCAAATGAATGACTCCATTGTATCTACCAGTGATATTAGATCGGTACTC
AGCCAACAAGCCTATGTGCTCTTTTATATCAGGTCCCATGATGTGAAAAATGGAGGTGAA
CTTACTCATCCCACCCATAGCCCCGGCCAGTCCTCTCCCCGCCCCGTCATCAGTCAGCGG
GTTGTCACCAACAAACAGGCTGCGCCAGGCTTTATCGGACCACAGCTTCCCTCTCACATG
ATAAAGAATCCACCTCACTTAAATGGGACTGGACCATTGAAAGACACGCCAAGCAGTTCC
ATGTCGAGTCCTAACGGGAATTCCAGTGTCAACAGGGCTAGTCCTGTTAATGCTTCAGCT
TCTGTCCAAAACTGGTCAGTTAATAGGTCCTCAGTGATCCCAGAACATCCTAAGAAACAA
AAAATTACAATCAGTATTCACAACAAGTTGCCTGTTCGCCAGTGTCAGTCTCAACCTAAC
CTTCATAGTAATTCTTTGGAGAACCCTACCAAGCCCGTTCCCTCTTCTACCATTACCAAT
TCTGCAGTACAGTCTACCTCGAACGCATCTACGATGTCAGTTTCTAGTAAAGTAACAAAA
CCGATCCCCCGCAGTGAATCCTGCTCCCAGCCCGTGATGAATGGCAAATCCAAGCTGAAC
TCCAGCGTGCTGGTGCCCTATGGCGCCGAGTCCTCTGAGGACTCTGACGAGGAGTCAAAG
GGGCTGGGCAAGGAGAATGGGATTGGTACGATTGTGAGCTCCCACTCTCCCGGCCAAGAT
GCCGAAGATGAGGAGGCCACTCCGCACGAGCTTCAAGAACCCATGACCCTAAACGGTGCT
AATAGTGCAGACAGCGACAGTGACCCGAAAGAAAACGGCCTAGCGCCTGATGGTGCCAGC
TGCCAAGGCCAGCCTGCCCTGCACTCAGAAAATCCCTTTGCTAAGGCAAACGGTCTTCCT
GGAAAGTTGATGCCTGCTCCTTTGCTGTCTCTCCCAGAAGACAAAATCTTAGAGACCTTC
AGGCTTAGCAACAAACTGAAAGGCTCGACGGATGAAATGAGTGCACCTGGAGCAGAGAGG
GGCCCTCCCGAGGACCGCGACGCCGAGCCTCAGCCTGGCAGCCCCGCCGCCGAATCCCTG
GAGGAGCCAGATGCGGCCGCCGGCCTCAGCAGCACCAAGAAGGCTCCGCCGCCCCGCGAT
CCCGGCACCCCCGCTACCAAAGAAGGCGCCTGGGAGGCCATGGCCGTCGCCCCCGAGGAG
CCTCCGCCCAGCGCCGGCGAGGACATCGTGGGGGACACAGCACCCCCTGACCTGTGTGAT
CCCGGGAGCTTAACAGGCGATGCGAGCCCGTTGTCCCAGGACGCAAAGGGGATGATCGCG
GAGGGCCCGCGGGACTCGGCGTTGGCGGAAGCCCCGGAAGGGTTGAGTCCGGCTCCGCCT
GCGCGGTCGGAGGAGCCCTGCGAGCAGCCACTCCTTGTTCACCCCAGCGGGGACCACGCC
CGGGACGCTCAGGACCCATCCCAGAGCTTGGGCGCACCCGAGGCCGCAGAGCGGCCGCCA
GCTCCTGTGCTGGACATGGCCCCGGCCGGTCACCCGGAAGGGGACGCTGAGCCTAGCCCC
GGCGAGAGGGTCGAGGACGCCGCGGCGCCGAAAGCCCCAGGCCCTTCCCCAGCGAAGGAG
AAAATCGGCAGCCTCAGAAAGGTGGACCGAGGCCACTACCGCAGCCGGAGAGAGCGCTCG
TCCAGCGGGGAGCCCGCCAGAGAGAGCAGGAGCAAGACTGAGGGCCACCGTCACCGGCGG
CGCCGCACCTGCCCCCGGGAGCGCGACCGCCAGGACCGCCACGCCCCGGAGCACCACCCC
GGCCACGGCGACAGGCTCAGCCCTGGCGAGCGCCGCTCTCTGGGCAGGTGCAGTCACCAC
CACTCCCGACACCGGAGCGGGGTGGAGCTGGACTGGGTCAGACACCACTACACCGAGGGC
GAGCGTGGCTGGGGCCGGGAGAAGTTCTACCCCGACAGGCCGCGCTGGGACAGGTGCCGG
TACTACCATGACAGGTACGCCCTGTACGCTGCCCGGGACTGGAAGCCCTTCCACGGCGGC
CGCGAGCACGAGCGGGCCGGGCTGCACGAGCGGCCGCACAAGGACCACAACCGGGGCCGT
AGGGGCTGCGAGCCGGCCCGGGAGAGGGAGCGGCACCGCCCCAGCAGCCCCCGCGCAGGC
GCGCCCCACGCCCTCGCCCCGCACCCCGACCGCTTCTCCCACGACAGAACTGCACTTGTA
GCCGGAGACAACTGTAACCTCTCTGATCGGTTTCACGAACACGAAAATGGAAAGTCCCGG
AAACGGAGACACGACAGTGTGGAGAACAGTGACAGTCATGTTGAAAAGAAAGCCCGGAGG
AGCGAACAGAAGGATCCTCTAGAAGAGCCTAAAGCAAAGAAGCACAAAAAATCAAAGAAG
AAAAAGAAATCCAAAGACAAACACCGAGACCGCGACTCCAGGCATCAGCAGGACTCAGAC
CTCTCAGCAGCGTGCTCTGACGCTGACCTCCACAGACACAAAAAAAAGAAGAAGAAAAAG
AAGAGACATTCAAGAAAATCAGAGGACTTTGTTAAAGATTCAGAACTGCACTTACCCAGG
GTCACCAGCTTGGAGACTGTCGCCCAGTTCCGGAGAGCCCAGGGTGGCTTTCCTCTCTCT
GGTGGCCCGCCTCTGGAAGGCGTCGGACCTTTCCGTGAGAAAACGAAACACTTACGGATG
GAAAGCAGGGATGACAGGTGTCGTCTCTTTGAGTATGGCCAGGGTGATTGA
Protein Properties
Number of Residues 1316
Molecular Weight 144333.5
Theoretical pI 8.61
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ubiquitin carboxyl-terminal hydrolase
MTIVDKASESSDPSAYQNQPGSSEAVSPGDMDAGSASWGAVSSLNDVSNHTLSLGPVPGA
VVYSSSSVPDKSKPSPQKDQALGDGIAPPQKVLFPSEKICLKWQQTHRVGAGLQNLGNTC
FANAALQCLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQAHITQALSNPGDVIKPMFVI
NEMRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQATTLVCQIFGGYLRS
RVKCLNCKGVSDTFDPYLDITLEIKAAQSVNKALEQFVKPEQLDGENSYKCSKCKKMVPA
SKRFTIHRSSNVLTLSLKRFANFTGGKIAKDVKYPEYLDIRPYMSQPNGEPIVYVLYAVL
VHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRSVLSQQAYVLFYIRSHDVKNGGE
LTHPTHSPGQSSPRPVISQRVVTNKQAAPGFIGPQLPSHMIKNPPHLNGTGPLKDTPSSS
MSSPNGNSSVNRASPVNASASVQNWSVNRSSVIPEHPKKQKITISIHNKLPVRQCQSQPN
LHSNSLENPTKPVPSSTITNSAVQSTSNASTMSVSSKVTKPIPRSESCSQPVMNGKSKLN
SSVLVPYGAESSEDSDEESKGLGKENGIGTIVSSHSPGQDAEDEEATPHELQEPMTLNGA
NSADSDSDPKENGLAPDGASCQGQPALHSENPFAKANGLPGKLMPAPLLSLPEDKILETF
RLSNKLKGSTDEMSAPGAERGPPEDRDAEPQPGSPAAESLEEPDAAAGLSSTKKAPPPRD
PGTPATKEGAWEAMAVAPEEPPPSAGEDIVGDTAPPDLCDPGSLTGDASPLSQDAKGMIA
EGPRDSALAEAPEGLSPAPPARSEEPCEQPLLVHPSGDHARDAQDPSQSLGAPEAAERPP
APVLDMAPAGHPEGDAEPSPGERVEDAAAPKAPGPSPAKEKIGSLRKVDRGHYRSRRERS
SSGEPARESRSKTEGHRHRRRRTCPRERDRQDRHAPEHHPGHGDRLSPGERRSLGRCSHH
HSRHRSGVELDWVRHHYTEGERGWGREKFYPDRPRWDRCRYYHDRYALYAARDWKPFHGG
REHERAGLHERPHKDHNRGRRGCEPARERERHRPSSPRAGAPHALAPHPDRFSHDRTALV
AGDNCNLSDRFHEHENGKSRKRRHDSVENSDSHVEKKARRSEQKDPLEEPKAKKHKKSKK
KKKSKDKHRDRDSRHQQDSDLSAACSDADLHRHKKKKKKKKRHSRKSEDFVKDSELHLPR
VTSLETVAQFRRAQGGFPLSGGPPLEGVGPFREKTKHLRMESRDDRCRLFEYGQGD
GenBank ID Protein 79750944
UniProtKB/Swiss-Prot ID Q9H9J4
UniProtKB/Swiss-Prot Entry Name A2RUE3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_032172.2
GeneCard ID USP42
GenAtlas ID USP42
HGNC ID HGNC:20068
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]