You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10131
Secondary Accession Numbers
  • 16087
Name Ubiquitin carboxyl-terminal hydrolase 30
Synonyms
  1. Deubiquitinating enzyme 30
  2. Ub-specific protease 30
  3. Ubiquitin thiolesterase 30
  4. Ubiquitin-specific-processing protease 30
Gene Name USP30
Protein Type Enzyme
Biological Properties
General Function Involved in ubiquitin thiolesterase activity
Specific Function May participate in the maintenance of mitochondrial morphology
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
ubiquitin thiolesterase activity
thiolester hydrolase activity
Process
metabolic process
catabolic process
macromolecule catabolic process
cellular macromolecule catabolic process
modification-dependent macromolecule catabolic process
modification-dependent protein catabolic process
ubiquitin-dependent protein catabolic process
Cellular Location
  1. Mitochondrion outer membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 12q24.11
SNPs USP30
Gene Sequence
>1554 bp
ATGCTGAGCTCCCGGGCCGAGGCGGCGATGACCGCGGCCGACAGGGCCATCCAGCGCTTC
CTGCGGACCGGGGCGGCCGTCAGATATAAAGTCATGAAGAACTGGGGAGTTATAGGTGGA
ATTGCTGCTGCTCTTGCAGCAGGAATATATGTTATTTGGGGTCCCATTACAGAAAGAAAG
AAGCGTAGAAAAGGGCTTGTGCCTGGCCTTGTTAATTTAGGGAACACCTGCTTCATGAAC
TCCCTGCTACAAGGCCTGTCTGCCTGTCCTGCTTTCATCAGGTGGCTGGAAGAGTTCACC
TCCCAGTACTCCAGGGATCAGAAGGAGCCCCCCTCACACCAGTATTTATCCTTAACACTC
TTGCACCTTCTGAAAGCCTTGTCCTGCCAAGAAGTTACTGATGATGAGGTCTTAGATGCA
AGCTGCTTGTTGGATGTCTTAAGAATGTACAGATGGCAGATCTCATCATTTGAAGAACAG
GATGCTCACGAATTATTCCATGTCATTACCTCGTCATTGGAAGATGAGCGAGACCGCCAG
CCTCGGGTCACACATTTGTTTGATGTGCATTCCCTGGAGCAGCAGTCAGAAATAACTCCC
AAACAAATTACCTGCCGCACAAGAGGGTCACCTCACCCCACATCCAATCACTGGAAGTCT
CAACATCCTTTTCATGGAAGACTCACTAGTAATATGGTCTGCAAACACTGTGAACACCAG
AGTCCTGTTCGATTTGATACCTTTGATAGCCTTTCACTAAGTATTCCAGCCGCCACATGG
GGTCACCCATTGACCCTGGACCACTGCCTTCACCACTTCATCTCATCAGAATCAGTGCGG
GATGTTGTGTGTGACAACTGTACAAAGATTGAAGCCAAGGGAACGTTGAACGGGGAAAAG
GTGGAACACCAGAGGACCACTTTTGTTAAACAGTTAAAACTAGGGAAGCTCCCTCAGTGT
CTCTGCATCCACCTACAGCGGCTGAGCTGGTCCAGCCACGGCACGCCTCTGAAGCGGCAT
GAGCACGTGCAGTTCAATGAGTTCCTGATGATGGACATTTACAAGTACCACCTCCTTGGA
CATAAACCTAGTCAACACAACCCTAAACTGAACAAGAACCCAGGGCCTACACTGGAGCTG
CAGGATGGGCCGGGAGCCCCCACACCAGTTCTGAATCAGCCAGGGGCCCCCAAAACACAG
ATTTTTATGAATGGCGCCTGCTCCCCATCTTTATTGCCAACGCTGTCAGCGCCGATGCCC
TTCCCTCTCCCAGTTGTTCCCGACTACAGCTCCTCCACATACCTCTTCCGGCTGATGGCA
GTTGTCGTCCACCATGGAGACATGCACTCTGGACACTTTGTCACTTACCGACGGTCCCCA
CCTTCTGCCAGGAACCCTCTCTCAACTAGCAATCAGTGGCTGTGGGTCTCCGATGACACT
GTCCGCAAGGCCAGCCTGCAGGAGGTCCTGTCCTCCAGCGCCTACCTGCTGTTCTACGAG
CGCGTCCTTTCCAGGATGCAGCACCAGAGCCAGGAGTGCAAGTCTGAAGAATGA
Protein Properties
Number of Residues 517
Molecular Weight 58502.4
Theoretical pI 8.34
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 36-56
Protein Sequence
>Ubiquitin carboxyl-terminal hydrolase 30
MLSSRAEAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERK
KRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTL
LHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQ
PRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQ
SPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEK
VEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLG
HKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMP
FPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDT
VRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE
GenBank ID Protein 40788029
UniProtKB/Swiss-Prot ID Q70CQ3
UniProtKB/Swiss-Prot Entry Name UBP30_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ586136
GeneCard ID USP30
GenAtlas ID USP30
HGNC ID HGNC:20065
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Quesada V, Diaz-Perales A, Gutierrez-Fernandez A, Garabaya C, Cal S, Lopez-Otin C: Cloning and enzymatic analysis of 22 novel human ubiquitin-specific proteases. Biochem Biophys Res Commun. 2004 Jan 30;314(1):54-62. [PubMed:14715245 ]
  4. Nakamura N, Hirose S: Regulation of mitochondrial morphology by USP30, a deubiquitinating enzyme present in the mitochondrial outer membrane. Mol Biol Cell. 2008 May;19(5):1903-11. doi: 10.1091/mbc.E07-11-1103. Epub 2008 Feb 20. [PubMed:18287522 ]