Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10132
Secondary Accession Numbers
  • 16088
Name Ubiquitin carboxyl-terminal hydrolase 13
Synonyms
  1. Deubiquitinating enzyme 13
  2. ISOT-3
  3. Isopeptidase T-3
  4. Ubiquitin thiolesterase 13
  5. Ubiquitin-specific-processing protease 13
Gene Name USP13
Protein Type Enzyme
Biological Properties
General Function Involved in ubiquitin thiolesterase activity
Specific Function Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C- terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal)
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
ubiquitin thiolesterase activity
thiolester hydrolase activity
Process
metabolic process
catabolic process
macromolecule catabolic process
cellular macromolecule catabolic process
modification-dependent macromolecule catabolic process
modification-dependent protein catabolic process
ubiquitin-dependent protein catabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:3
Locus 3q26.2-q26.3
SNPs USP13
Gene Sequence
>2592 bp
ATGCAGCGCCGGGGCGCCCTGTTCGGCATGCCGGGCGGCAGCGGAGGCAGGAAGATGGCT
GCAGGAGACATCGGCGAGCTGCTAGTGCCCCACATGCCCACGATCCGCGTGCCCAGGTCC
GGCGACAGGGTCTACAAGAACGAGTGCGCCTTCTCCTACGACTCTCCCAATTCTGAAGGT
GGACTCTATGTATGCATGAATACATTTTTGGCCTTTGGAAGGGAACATGTTGAAAGACAT
TTTCGAAAAACTGGACAGAGTGTATACATGCACCTGAAAAGACATGTGCGAGAGAAGGTA
AGAGGGGCGTCTGGTGGAGCGTTACCAAAAAGGAGGAATTCCAAGATTTTTTTAGATCTA
GATACTGATGACGATTTAAATAGCGACGATTATGAATATGAAGATGAAGCCAAACTTGTT
ATATTCCCAGATCACTATGAAATAGCACTACCAAATATTGAGGAGTTACCAGCCCTGGTA
ACAATTGCTTGTGATGCAGTTCTCAGCTCAAAATCTCCATACAGAAAGCAGGACCCAGAC
ACGTGGGAAAATGAATTGCCAGTATCTAAATATGCCAACAACCTCACCCAGCTGGACAAT
GGAGTCAGGATTCCTCCAAGTGGTTGGAAGTGTGCCAGATGCGACCTGCGAGAAAACCTC
TGGTTGAATCTGACTGACGGCTCTGTCCTGTGTGGAAAGTGGTTCTTTGACAGCTCTGGG
GGCAACGGGCATGCGCTGGAGCATTACAGAGACATGGGCTACCCACTAGCCGTGAAACTG
GGAACCATCACTCCTGACGGGGCAGATGTTTATTCTTTTCAAGAAGAAGAACCTGTTTTG
GATCCTCATTTGGCCAAGCACTTAGCGCATTTTGGAATTGATATGCTTCATATGCATGGG
ACAGAGAATGGGCTCCAGGACAATGACATCAAGCTGAGGGTCAGTGAGTGGGAAGTGATC
CAGGAGTCGGGCACGAAACTGAAGCCAATGTATGGTCCTGGCTACACGGGTCTGAAGAAC
CTGGGCAACAGCTGCTATCTCAGCTCTGTCATGCAGGCCATCTTCAGCATCCCAGAATTC
CAGAGAGCGTATGTAGGAAACCTTCCCAGAATATTTGACTACTCGCCTTTAGATCCAACA
CAAGATTTCAACACACAGATGACTAAGTTAGGACATGGCCTTCTCTCAGGCCAGTATTCA
AAGCCTCCGGTGAAATCTGAACTCATTGAACAGGTGATGAAGGAGGAGCACAAGCCACAG
CAGAACGGGATCTCTCCGCGCATGTTTAAGGCCTTTGTAAGCAAGAGCCACCCGGAATTC
TCCTCTAACAGGCAGCAAGATGCCCAGGAATTCTTCTTGCACCTGGTGAATCTAGTAGAG
AGGAACCGCATCGGCTCAGAAAACCCAAGCGATGTTTTTCGTTTTTTGGTGGAAGAACGC
ATTCAGTGCTGTCAGACCCGGAAAGTCCGCTACACGGAGAGGGTGGATTACCTGATGCAG
TTACCTGTGGCCATGGAGGCGGCAACCAACAAGGATGAACTGATCGCTTATGAACTAACG
AGAAGGGAAGCAGAAGCAAACAGAAGACCCCTTCCTGAGTTGGTACGTGCCAAGATACCA
TTTAGTGCCTGCCTTCAGGCCTTCTCTGAACCAGAAAATGTTGATGATTTCTGGAGCAGT
GCCCTACAAGCAAAGTCTGCGGGTGTGAAAACATCTCGCTTTGCTTCATTCCCTGAATAC
TTGGTAGTGCAGATAAAGAAGTTCACTTTTGGTCTTGACTGGGTTCCCAAAAAATTTGAT
GTTTCTATTGATATGCCAGACCTACTTGATATCAACCATCTCCGAGCCAGGGGGTTACAG
CCAGGAGAGGAAGAACTTCCAGACATCAGCCCCCCCATAGTCATTCCTGATGACTCAAAA
GATCGCCTGATGAACCAATTGATAGACCCATCAGACATCGATGAGTCATCAGTGATGCAG
CTGGCCGAGATGGGTTTCCCGCTGGAAGCATGTCGCAAGGCTGTGTACTTCACTGGAAAT
ATGGGCGCCGAGGTGGCCTTCAACTGGATCATTGTTCACATGGAAGAGCCAGATTTTGCT
GAGCCGCTGACCATGCCTGGTTATGGAGGGGCAGCTTCTGCTGGAGCCTCTGTTTTTGGT
GCTTCTGGACTGGATAACCAACCTCCAGAGGAAATCGTAGCTATCATCACCTCCATGGGA
TTTCAGCGAAATCAGGCTATTCAGGCACTACGAGCAACGAATAATAACCTGGAAAGAGCA
CTGGATTGGATCTTTAGCCACCCTGAGTTTGAAGAAGACAGTGATTTTGTGATTGAGATG
GAGAATAATGCCAATGCAAACATTATTTCTGAGGCCAAGCCCGAAGGACCTAGAGTCAAG
GATGGATCTGGAACATATGAGCTATTTGCATTCATCAGTCACATGGGAACATCCACAATG
AGTGGTCATTACATTTGCCATATCAAAAAGGAAGGAAGATGGGTGATTTACAATGACCAC
AAAGTTTGTGCCTCAGAAAGGCCCCCTAAAGACCTGGGCTACATGTACTTTTACCGCAGG
ATACCAAGCTAA
Protein Properties
Number of Residues 863
Molecular Weight 97326.3
Theoretical pI 5.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ubiquitin carboxyl-terminal hydrolase 13
MQRRGALFGMPGGSGGRKMAAGDIGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEG
GLYVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKIFLDL
DTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPD
TWENELPVSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSG
GNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMHG
TENGLQDNDIKLRVSEWEVIQESGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEF
QRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQ
QNGISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEER
IQCCQTRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPELVRAKIP
FSACLQAFSEPENVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFD
VSIDMPDLLDINHLRARGLQPGEEELPDISPPIVIPDDSKDRLMNQLIDPSDIDESSVMQ
LAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFG
ASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFVIEM
ENNANANIISEAKPEGPRVKDGSGTYELFAFISHMGTSTMSGHYICHIKKEGRWVIYNDH
KVCASERPPKDLGYMYFYRRIPS
GenBank ID Protein 16359380
UniProtKB/Swiss-Prot ID Q92995
UniProtKB/Swiss-Prot Entry Name UBP13_HUMAN
PDB IDs Not Available
GenBank Gene ID BC016146
GeneCard ID USP13
GenAtlas ID USP13
HGNC ID HGNC:12611
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Timms KM, Ansari-Lari MA, Morris W, Brown SN, Gibbs RA: The genomic organization of Isopeptidase T-3 (ISOT-3), a new member of the ubiquitin specific protease family (UBP). Gene. 1998 Sep 14;217(1-2):101-6. [PubMed:9841226 ]