Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10135
Secondary Accession Numbers
  • 16091
Name Ubiquitin carboxyl-terminal hydrolase 10
Synonyms
  1. Deubiquitinating enzyme 10
  2. Ubiquitin thiolesterase 10
  3. Ubiquitin-specific-processing protease 10
Gene Name USP10
Protein Type Enzyme
Biological Properties
General Function Involved in ubiquitin thiolesterase activity
Specific Function Hydrolase that can remove conjugated ubiquitin from target proteins such as p53/TP53, SNX3 and CFTR. Acts as an essential regulator of p53/TP53 stability:in unstressed cells, specifically deubiquitinates p53/TP53 in the cytoplasm, leading to counteract MDM2 action and stabilize p53/TP53. Following DNA damage, translocates to the nucleus and deubiquitinates p53/TP53, leading to regulate the p53/TP53-dependent DNA damage response. Does not deubiquitinate MDM2. Deubiquitinates CFTR in early endosomes, enhancing its endocytic recycling
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
ubiquitin thiolesterase activity
thiolester hydrolase activity
Process
metabolic process
catabolic process
macromolecule catabolic process
cellular macromolecule catabolic process
modification-dependent macromolecule catabolic process
modification-dependent protein catabolic process
ubiquitin-dependent protein catabolic process
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. Early endosome
Gene Properties
Chromosome Location Chromosome:1
Locus 16q24.1
SNPs USP10
Gene Sequence
>2397 bp
ATGGCCCTCCACAGCCCGCAGTATATTTTTGGAGATTTTAGCCCTGATGAATTCAATCAA
TTCTTTGTGACTCCTCGATCTTCAGTTGAGCTTCCTCCATACAGTGGAACAGTTCTGTGT
GGCACACAGGCTGTGGATAAACTACCTGATGGACAAGAATATCAGAGAATTGAGTTTGGT
GTCGATGAAGTCATTGAACCCAGTGACACTTTGCCGAGAACCCCCAGCTACAGTATTTCA
AGCACACTGAACCCTCAGGCCCCTGAATTTATTCTCGGTTGTACAGCTTCCAAAATAACC
CCTGATGGTATCACTAAAGAAGCAAGCTATGGCTCCATCGACTGCCAGTACCCAGGCTCT
GCCCTCGCTTTGGATGGAAGTTCTAATGTGGAGGCGGAAGTTTTGGAAAATGATGGTGTC
TCAGGTGGTCTTGGACAAAGGGAGCGTAAAAAGAAGAAAAAGCGGCCACCTGGATATTAC
AGCTATTTGAAAGATGGTGGCGATGATAGTATCTCCACAGAAGCCCTGGTCAATGGCCAT
GCCAATTCAGCAGTCCCGAACAGTGTCAGTGCAGAGGATGCAGAATTTATGGGTGACATG
CCCCCGTCAGTTACGCCCAGGACTTGTAACAGCCCCCAGAACTCCACAGACTCTGTCAGT
GACATTGTGCCTGACAGTCCTTTCCCCGGAGCACTCGGCAGTGACACCAGGACTGCAGGG
CAGCCAGAGGGGGGCCCCGGGGCTGATTTTGGTCAGTCCTGCTTCCCTGCAGAGGCTGGC
AGAGACACCCTGTCAAGGACAGCTGGGGCTCAGCCCTGCGTTGGTACCGATACTACTGAA
AACCTTGGAGTTGCTAATGGACAAATACTTGAATCCTCGGGTGAGGGCACAGCTACCAAC
GGGGTGGAGTTGCACACCACGGAAAGCATAGACTTGGACCCAACCAAACCCGAGAGTGCA
TCACCTCCTGCTGACGGCACGGGCTCTGCATCAGGCACCCTTCCTGTCAGCCAGCCCAAG
TCCTGGGCCAGCCTCTTTCATGATTCTAAGCCCTCTTCCTCCTCGCCGGTGGCCTATGTG
GAAACTAAGTATTCCCCTCCCGCCATATCTCCCCTGGTTTCTGAAAAGCAGGTTGAAGTC
AAAGAAGGGCTTGTTCCGGTTTCAGAGGATCCTGTAGCCATAAAGATTGCAGAGTTGCTG
GAGAATGTAACCCTAATCCATAAACCAGTGTCGTTGCAACCCCGTGGGCTGATCAATAAA
GGGAACTGGTGCTACATTAATGCTACACTGCAGGCATTGGTTGCTTGCCCGCCGATGTAC
CACCTGATGAAGTTCATTCCTCTGTATTCCAAAGTGCAAAGGCCTTGTACGTCAACACCC
ATGATAGACAGCTTTGTTCGGCTAATGAATGAGTTCACTAATATGCCAGTACCTCCAAAA
CCCCGACAAGCTCTTGGAGATAAAATCGTGAGGGATATTCGCCCTGGAGCTGCCTTTGAG
CCCACATATATTTACAGACTCCTGACAGTTAACAAGTCAAGCCTGTCTGAAAAGGGTCGA
CAAGAAGATGCTGAGGAATACTTAGGCTTCATTCTAAATGGACTTCATGAGGAAATGTTG
AACCTAAAGAAGCTTCTCTCACCAAGTAATGAAAAACTTACGATTTCCAACGGCCCCAAA
AACCACTCGGTCAATGAAGAAGAGCAGGAAGAACAAGGTGAAGGAAGCGAGGATGAATGG
GAACAAGTGGGCCCCCGGAACAAGACTTCCGTCACCCGCCAGGCGGATTTTGTTCAGACT
CCAATCACCGGCATTTTTGGTGGACACATCAGGTCTGTGGTTTACCAGCAGAGTTCAAAA
GAATCTGCCACTTTGCAGCCATTTTTCACGTTGCAGTTGGATATCCAGTCAGACAAGATA
CGCACAGTCCAGGATGCACTGGAGAGCTTGGTGGCAAGAGAATCTGTCCAAGGTTATACC
ACAAAAACCAAACAAGAGGTTGAGATAAGTCGAAGAGTGACTCTGGAAAAACTCCCTCCT
GTCCTCGTGCTGCACCTGAAACGATTCGTTTATGAGAAGACTGGTGGGTGCCAGAAGCTT
ATCAAAAATATTGAATATCCTGTGGACTTGGAAATTAGTAAAGAACTGCTTTCTCCAGGG
GTTAAAAATAAGAATTTTAAATGCCACCGAACCTATCGGCTCTTTGCAGTGGTCTACCAT
CACGGCAACAGTGCGACGGGCGGCCATTACACTACAGACGTCTTCCAGATCGGTCTGAAT
GGCTGGCTGCGCATCGATGACCAGACAGTCAAGGTGATCAACCAGTACCAGGTGGTGAAA
CCAACTGCTGAACGCACAGCCTACCTCCTGTATTACCGCCGAGTGGACCTGCTGTAA
Protein Properties
Number of Residues 798
Molecular Weight 87133.1
Theoretical pI 4.96
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ubiquitin carboxyl-terminal hydrolase 10
MALHSPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTVLCGTQAVDKLPDGQEYQRIEFG
VDEVIEPSDTLPRTPSYSISSTLNPQAPEFILGCTASKITPDGITKEASYGSIDCQYPGS
ALALDGSSNVEAEVLENDGVSGGLGQRERKKKKKRPPGYYSYLKDGGDDSISTEALVNGH
ANSAVPNSVSAEDAEFMGDMPPSVTPRTCNSPQNSTDSVSDIVPDSPFPGALGSDTRTAG
QPEGGPGADFGQSCFPAEAGRDTLSRTAGAQPCVGTDTTENLGVANGQILESSGEGTATN
GVELHTTESIDLDPTKPESASPPADGTGSASGTLPVSQPKSWASLFHDSKPSSSSPVAYV
ETKYSPPAISPLVSEKQVEVKEGLVPVSEDPVAIKIAELLENVTLIHKPVSLQPRGLINK
GNWCYINATLQALVACPPMYHLMKFIPLYSKVQRPCTSTPMIDSFVRLMNEFTNMPVPPK
PRQALGDKIVRDIRPGAAFEPTYIYRLLTVNKSSLSEKGRQEDAEEYLGFILNGLHEEML
NLKKLLSPSNEKLTISNGPKNHSVNEEEQEEQGEGSEDEWEQVGPRNKTSVTRQADFVQT
PITGIFGGHIRSVVYQQSSKESATLQPFFTLQLDIQSDKIRTVQDALESLVARESVQGYT
TKTKQEVEISRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLIKNIEYPVDLEISKELLSPG
VKNKNFKCHRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVK
PTAERTAYLLYYRRVDLL
GenBank ID Protein 119220605
UniProtKB/Swiss-Prot ID Q14694
UniProtKB/Swiss-Prot Entry Name UBP10_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005153.2
GeneCard ID USP10
GenAtlas ID USP10
HGNC ID HGNC:12608
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  9. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  10. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  11. Giorgianni F, Zhao Y, Desiderio DM, Beranova-Giorgianni S: Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line. Electrophoresis. 2007 Jun;28(12):2027-34. [PubMed:17487921 ]
  12. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  13. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553 ]
  14. Tang LY, Deng N, Wang LS, Dai J, Wang ZL, Jiang XS, Li SJ, Li L, Sheng QH, Wu DQ, Li L, Zeng R: Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction. Mol Cell Proteomics. 2007 Nov;6(11):1952-67. Epub 2007 Aug 12. [PubMed:17693683 ]
  15. Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J: Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography. Proteomics. 2008 Apr;8(7):1346-61. doi: 10.1002/pmic.200700884. [PubMed:18318008 ]
  16. Nagase T, Seki N, Ishikawa K, Tanaka A, Nomura N: Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1996 Feb 29;3(1):17-24. [PubMed:8724849 ]
  17. Bomberger JM, Barnaby RL, Stanton BA: The deubiquitinating enzyme USP10 regulates the post-endocytic sorting of cystic fibrosis transmembrane conductance regulator in airway epithelial cells. J Biol Chem. 2009 Jul 10;284(28):18778-89. doi: 10.1074/jbc.M109.001685. Epub 2009 Apr 27. [PubMed:19398555 ]
  18. Yuan J, Luo K, Zhang L, Cheville JC, Lou Z: USP10 regulates p53 localization and stability by deubiquitinating p53. Cell. 2010 Feb 5;140(3):384-96. doi: 10.1016/j.cell.2009.12.032. Epub 2010 Jan 21. [PubMed:20096447 ]
  19. Soncini C, Berdo I, Draetta G: Ras-GAP SH3 domain binding protein (G3BP) is a modulator of USP10, a novel human ubiquitin specific protease. Oncogene. 2001 Jun 28;20(29):3869-79. [PubMed:11439350 ]
  20. Boulkroun S, Ruffieux-Daidie D, Vitagliano JJ, Poirot O, Charles RP, Lagnaz D, Firsov D, Kellenberger S, Staub O: Vasopressin-inducible ubiquitin-specific protease 10 increases ENaC cell surface expression by deubiquitylating and stabilizing sorting nexin 3. Am J Physiol Renal Physiol. 2008 Oct;295(4):F889-900. doi: 10.1152/ajprenal.00001.2008. Epub 2008 Jul 16. [PubMed:18632802 ]