Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10633
Secondary Accession Numbers
  • 16862
Name Vitamin K epoxide reductase complex subunit 1-like protein 1
Synonyms
  1. VKORC1-like protein 1
Gene Name VKORC1L1
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:7
Locus 7q11.21
SNPs VKORC1L1
Gene Sequence
>531 bp
ATGGCGGCTCCCGTCCTGCTAAGAGTGTCGGTGCCGCGGTGGGAGCGGGTGGCCCGGTAT
GCAGTGTGCGCTGCCGGAATCCTGCTCTCCATCTACGCCTACCACGTGGAGCGGGAGAAG
GAGCGGGACCCCGAGCACCGGGCCCTCTGCGACCTGGGGCCCTGGGTGAAGTGCTCCGCC
GCCCTTGCCTCCAGATGGGGTCGAGGATTTGGTCTTTTGGGTTCCATTTTTGGAAAGGAT
GGTGTATTAAACCAGCCAAACAGTGTCTTTGGACTTATATTTTATATACTACAGTTATTA
CTTGGCATGACAGCAAGCGCTGTGGCGGCTTTGATCCTCATGACGTCCTCCATCATGTCG
GTCGTGGGGTCCCTGTACCTGGCCTACATTCTGTACTTTGTGCTGAAGGAGTTCTGCATC
ATCTGCATCGTCACGTACGTGCTGAACTTCCTTCTTCTCATTATCAACTACAAACGACTA
GTTTACTTGAACGAGGCCTGGAAGCGGCAGCTGCAACCCAAGCAGGACTGA
Protein Properties
Number of Residues 176
Molecular Weight 19835.4
Theoretical pI 9.35
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 17-37
  • 92-112
  • 114-134
  • 135-155
Protein Sequence
>Vitamin K epoxide reductase complex subunit 1-like protein 1
MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSA
ALASRWGRGFGLLGSIFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALILMTSSIMS
VVGSLYLAYILYFVLKEFCIICIVTYVLNFLLLIINYKRLVYLNEAWKRQLQPKQD
GenBank ID Protein 40217985
UniProtKB/Swiss-Prot ID Q8N0U8
UniProtKB/Swiss-Prot Entry Name VKORL_HUMAN
PDB IDs Not Available
GenBank Gene ID AY423045
GeneCard ID VKORC1L1
GenAtlas ID VKORC1L1
HGNC ID HGNC:21492
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Rost S, Fregin A, Ivaskevicius V, Conzelmann E, Hortnagel K, Pelz HJ, Lappegard K, Seifried E, Scharrer I, Tuddenham EG, Muller CR, Strom TM, Oldenburg J: Mutations in VKORC1 cause warfarin resistance and multiple coagulation factor deficiency type 2. Nature. 2004 Feb 5;427(6974):537-41. [PubMed:14765194 ]