You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10639
Secondary Accession Numbers
  • 16868
Name Mitochondrial Rho GTPase 1
Synonyms
  1. MIRO-1
  2. Rac-GTP-binding protein-like protein
  3. Ras homolog gene family member T1
  4. hMiro-1
Gene Name RHOT1
Protein Type Enzyme
Biological Properties
General Function Involved in calcium ion binding
Specific Function Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
organelle membrane
intracellular
mitochondrial membrane
mitochondrial outer membrane
Function
ion binding
cation binding
metal ion binding
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
calcium ion binding
Process
cellular process
biological regulation
regulation of biological process
microtubule-based process
microtubule-based movement
regulation of cellular process
signal transduction
microtubule-based transport
mitochondrion transport along microtubule
intracellular signal transduction
small gtpase mediated signal transduction
Cellular Location
  1. Mitochondrion outer membrane
  2. Single-pass type IV membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 17q11.2
SNPs RHOT1
Gene Sequence
>1857 bp
ATGAAGAAAGACGTGCGGATCCTGCTGGTGGGAGAACCTAGAGTTGGGAAGACATCACTG
ATTATGTCTCTGGTCAGTGAAGAATTTCCAGAAGAGGTTCCTCCCCGGGCAGAAGAAATC
ACCATTCCAGCTGATGTCACCCCAGAGAGAGTTCCAACACACATTGTAGATTACTCAGAA
GCAGAACAGAGTGATGAACAACTTCATCAAGAAATATCTCAGGCTAATGTCATCTGTATA
GTGTATGCCGTTAACAACAAGCATTCTATTGATAAGGTAACAAGTCGATGGATTCCTCTC
ATAAATGAAAGAACAGACAAAGACAGCAGGCTGCCTTTAATATTGGTTGGGAACAAATCT
GATCTGGTGGAATATAGTAGTATGGAGACCATCCTTCCTATTATGAACCAGTATACAGAA
ATAGAAACCTGTGTGGAGTGTTCAGCGAAAAACCTGAAGAACATATCAGAGCTCTTTTAT
TACGCACAGAAAGCTGTTCTTCATCCTACAGGGCCCCTGTACTGCCCAGAGGAGAAGGAG
ATGAAACCAGCTTGTATAAAAGCCCTTACTCGTATATTTAAAATATCTGATCAAGATAAT
GATGGTACTCTCAATGATGCTGAACTCAACTTCTTTCAGAGGATTTGTTTCAACACTCCA
TTAGCTCCTCAAGCTCTGGAGGATGTCAAGAATGTAGTCAGAAAACATATAAGTGATGGT
GTGGCTGACAGTGGGTTGACCCTGAAAGGTTTTCTCTTTTTACACACACTTTTTATCCAG
AGAGGGAGACACGAAACTACTTGGACTGTGCTTCGACGATTTGGTTATGATGATGACCTG
GATTTGACACCTGAATATTTGTTCCCCCTGCTGAAAATACCTCCTGATTGCACTACTGAA
TTAAATCATCATGCATATTTATTTCTCCAAAGCACCTTTGACAAGCATGATTTGGATAGA
GACTGTGCTTTGTCACCTGATGAGCTTAAAGATTTATTTAAAGTTTTCCCTTACATACCT
TGGGGGCCAGATGTGAATAACACAGTTTGTACCAATGAAAGAGGCTGGATAACCTACCAG
GGATTCCTTTCCCAGTGGACGCTCACGACTTATTTAGATGTACAGCGGTGCCTGGAATAT
TTGGGCTATCTAGGCTATTCAATATTGACTGAGCAAGAGTCTCAAGCTTCAGCTGTTACA
GTGACAAGAGATAAAAAGATAGACCTGCAGAAAAAACAAACTCAAAGAAATGTGTTCAGA
TGTAATGTAATTGGAGTGAAAAACTGTGGGAAAAGTGGAGTTCTTCAGGCTCTTCTTGGA
AGAAACTTAATGAGGCAGAAGAAAATTCGTGAAGATCATAAATCCTACTATGCGATTAAC
ACTGTTTATGTATATGGACAAGAGAAATACTTGTTGTTGCATGATATCTCAGAATCGGAA
TTTCTAACTGAAGCTGAAATCATTTGTGATGTTGTATGCCTGGTATATGATGTCAGCAAT
CCCAAATCCTTTGAATACTGTGCCAGGATTTTTAAGCAACACTTTATGGACAGCAGAATA
CCTTGCTTAATCGTAGCTGCAAAGTCAGACCTGCATGAAGTTAAACAAGAATACAGTATT
TCACCTACTGATTTCTGCAGGAAACACAAAATGCCTCCACCACAAGCCTTCACTTGCAAT
ACTGCTGATGCCCCCAGTAAGGATATCTTTGTTAAATTGACAACAATGGCCATGTATCCG
CACGTGACACAAGCTGACCTCAAGAGCTCCACGTTTTGGCTTCGAGCAAGTTTTGGTGCT
ACTGTTTTTGCAGTTTTGGGCTTTGCTATGTACAAAGCATTATTGAAACAGCGATGA
Protein Properties
Number of Residues 618
Molecular Weight 70783.5
Theoretical pI 6.21
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 593-615
Protein Sequence
>Mitochondrial Rho GTPase 1
MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSE
AEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKS
DLVEYSSMETILPIMNQYTEIETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKE
MKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDVKNVVRKHISDG
VADSGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTE
LNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVCTNERGWITYQ
GFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAVTVTRDKKIDLQKKQTQRNVFR
CNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKSYYAINTVYVYGQEKYLLLHDISESE
FLTEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSI
SPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYPHVTQADLKSSTFWLRASFGA
TVFAVLGFAMYKALLKQR
GenBank ID Protein 75750470
UniProtKB/Swiss-Prot ID Q8IXI2
UniProtKB/Swiss-Prot Entry Name MIRO1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_018307.3
GeneCard ID RHOT1
GenAtlas ID RHOT1
HGNC ID HGNC:21168
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  5. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  6. Jenne DE, Tinschert S, Dorschner MO, Hameister H, Stephens K, Kehrer-Sawatzki H: Complete physical map and gene content of the human NF1 tumor suppressor region in human and mouse. Genes Chromosomes Cancer. 2003 Jun;37(2):111-20. [PubMed:12696059 ]
  7. Fransson A, Ruusala A, Aspenstrom P: Atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis. J Biol Chem. 2003 Feb 21;278(8):6495-502. Epub 2002 Dec 12. [PubMed:12482879 ]
  8. Aspenstrom P, Fransson A, Saras J: Rho GTPases have diverse effects on the organization of the actin filament system. Biochem J. 2004 Jan 15;377(Pt 2):327-37. [PubMed:14521508 ]
  9. Fransson S, Ruusala A, Aspenstrom P: The atypical Rho GTPases Miro-1 and Miro-2 have essential roles in mitochondrial trafficking. Biochem Biophys Res Commun. 2006 Jun 2;344(2):500-10. Epub 2006 Apr 3. [PubMed:16630562 ]