You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10645
Secondary Accession Numbers
  • 16875
Name Phospholipase D6
Synonyms
  1. Choline phosphatase 6
  2. PLD 6
  3. Phosphatidylcholine-hydrolyzing phospholipase D6
Gene Name PLD6
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function A phosphatidylcholine + H(2)O = choline + a phosphatidate
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
Process
metabolic process
Cellular Location
  1. Membrane
  2. Single-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 17p11.2
SNPs PLD6
Gene Sequence
>759 bp
ATGGGACGGTTGAGTTGGCAGGTGGCGGCCGCGGCGGCTGTGGGCCTGGCTCTGACTCTG
GAGGCGCTGCCTTGGGTGCTGCGCTGGCTGCGGTCCAGGCGGCGGCGGCCGCGGCGCGAG
GCGCTGTTCTTCCCGTCTCAGGTGACCTGTACCGAGGCCCTGCTGCGGGCTCCGGGCGCG
GAGCTGGCCGAGCTCCCCGAGGGCTGCCCGTGCGGCCTGCCCCACGGCGAGAGCGCGCTA
AGCCGCCTGCTGCGTGCCCTGCTGGCCGCCCGCGCCAGCCTGGATCTCTGCCTGTTCGCC
TTCTCCAGCCCGCAGCTGGGCCGCGCCGTGCAGTTGCTGCACCAGCGTGGGGTGCGAGTG
CGGGTCGTCACCGACTGCGACTACATGGCCCTCAACGGCTCGCAAATCGGTCTGCTGCGC
AAGGCAGGGATCCAGGTCCGGCACGATCAAGACCCAGGCTACATGCATCACAAGTTTGCC
ATCGTGGACAAGAGGGTGCTCATCACTGGCTCGCTCAACTGGACCACGCAAGCCATCCAG
AACAACAGGGAGAATGTTCTCATCACGGAGGACGACGAGTACGTGCGGCTTTTTCTGGAA
GAATTTGAGCGCATCTGGGAACAGTTTAACCCTACAAAGTATACCTTTTTCCCACCAAAG
AAAAGTCACGGAAGCTGTGCCCCACCTGTCTCCAGAGCTGGAGGGAGATTGCTTTCATGG
CACAGAACTTGCGGCACCTCCAGCGAAAGCCAAACCTAA
Protein Properties
Number of Residues 252
Molecular Weight 28272.3
Theoretical pI 9.67
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 5-27
Protein Sequence
>Phospholipase D6
MGRLSWQVAAAAAVGLALTLEALPWVLRWLRSRRRRPRREALFFPSQVTCTEALLRAPGA
ELAELPEGCPCGLPHGESALSRLLRALLAARASLDLCLFAFSSPQLGRAVQLLHQRGVRV
RVVTDCDYMALNGSQIGLLRKAGIQVRHDQDPGYMHHKFAIVDKRVLITGSLNWTTQAIQ
NNRENVLITEDDEYVRLFLEEFERIWEQFNPTKYTFFPPKKSHGSCAPPVSRAGGRLLSW
HRTCGTSSESQT
GenBank ID Protein 21749147
UniProtKB/Swiss-Prot ID Q8N2A8
UniProtKB/Swiss-Prot Entry Name PLD6_HUMAN
PDB IDs Not Available
GenBank Gene ID AK090899
GeneCard ID PLD6
GenAtlas ID PLD6
HGNC ID HGNC:30447
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]