You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10653
Secondary Accession Numbers
  • 16890
Name 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1
Synonyms
  1. Termination and polyadenylation 1 homolog
Gene Name OGFOD1
Protein Type Enzyme
Biological Properties
General Function Involved in iron ion binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors
l-ascorbic acid binding
iron ion binding
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
vitamin binding
oxidoreductase activity
Process
metabolic process
oxidation reduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 16q12.2
SNPs OGFOD1
Gene Sequence
>1629 bp
ATGAATGGGAAGCGGCCAGCGGAGCCCGGCCCAGCCCGGGTGGGAAAAAAGGGAAAGAAG
GAGGTGATGGCGGAGTTTTCGGACGCTGTTACGGAAGAAACCTTGAAAAAGCAGGTGGCT
GAGGCCTGGAGCCGCAGGACGCCGTTCAGTCACGAAGTCATTGTCATGGACATGGACCCT
TTTCTTCACTGTGTGATCCCAAACTTCATCCAAAGCCAAGACTTCTTAGAAGGGCTTCAG
AAGGAACTGATGAACTTGGACTTCCATGAGAAGTATAATGATTTATATAAGTTCCAGCAG
TCTGATGATTTGAAGAAGAGAAGAGAGCCTCACATCTCCACTTTAAGGAAAATTCTGTTT
GAAGATTTCCGGTCCTGGCTTTCTGATATTTCTAAAATTGACCTGGAATCAACCATTGAC
ATGTCCTGTGCTAAATATGAATTCACTGATGCCCTGCTGTGCCATGATGATGAGCTGGAA
GGGCGCCGGATTGCCTTCATCCTGTACCTGGTTCCTCCCTGGGACAGGAGCATGGGTGGT
ACCCTGGACCTGTACAGCATTGATGAACACTTTCAGCCGAAGCAGATTGTCAAGTCTCTT
ATCCCTTCGTGGAACAAACTGGTTTTCTTTGAAGTATCTCCTGTGTCCTTTCACCAGGTG
TCTGAAGTGCTGTCTGAAGAAAAGTCACGTTTGTCTATAAGTGGCTGGTTTCATGGTCCA
TCATTGACTCGGCCTCCCAACTACTTTGAACCCCCCATACCTCGGAGCCCTCACATCCCA
CAAGATCATGAGATTTTGTATGATTGGATCAACCCTACTTATCTGGACATGGATTACCAA
GTTCAAATTCAAGAAGAGTTTGAAGAAAGTTCTGAAATTCTCCTGAAGGAGTTTCTTAAG
CCTGAGAAATTCACGAAAGTCTGTGAGGCCTTGGAGCATGGACATGTGGAATGGAGCAGC
CGAGGTCCCCCTAACAAAAGGTTTTATGAGAAAGCTGAGGAGAGTAAGCTTCCTGAGATA
TTGAAGGAGTGCATGAAGTTATTTCGCTCTGAGGCACTATTCTTGCTGCTCTCCAACTTC
ACAGGCCTGAAGCTTCATTTCTTGGCCCCTTCGGAAGAAGATGAGATGAATGATAAAAAA
GAGGCAGAAACCACTGATATCACTGAAGAAGGGACTAGCCATAGTCCTCCTGAGCCAGAG
AATAATCAGATGGCCATCAGCAACAACAGCCAACAGAGCAATGAGCAGACAGACCCAGAG
CCAGAGGAAAATGAAACAAAGAAAGAATCAAGTGTTCCCATGTGCCAAGGGGAACTGAGG
CATTGGAAGACCGGTCACTACACTTTAATTCATGACCATAGCAAGGCTGAATTTGCCCTA
GACTTAATTCTGTACTGTGGCTGTGAAGGCTGGGAGCCAGAATATGGCGGTTTTACTTCT
TACATTGCCAAAGGTGAAGATGAAGAGCTGCTAACAGTGAATCCAGAAAGCAATTCTTTG
GCATTGGTCTACAGAGACAGAGAGACTCTGAAATTTGTCAAGCATATTAACCACCGAAGC
CTGGAACAAAAGAAAACCTTCCCAAACAGAACAGGTTTCTGGGACTTTTCATTCATCTAT
TATGAATGA
Protein Properties
Number of Residues 542
Molecular Weight 63245.7
Theoretical pI 4.77
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1
MNGKRPAEPGPARVGKKGKKEVMAEFSDAVTEETLKKQVAEAWSRRTPFSHEVIVMDMDP
FLHCVIPNFIQSQDFLEGLQKELMNLDFHEKYNDLYKFQQSDDLKKRREPHISTLRKILF
EDFRSWLSDISKIDLESTIDMSCAKYEFTDALLCHDDELEGRRIAFILYLVPPWDRSMGG
TLDLYSIDEHFQPKQIVKSLIPSWNKLVFFEVSPVSFHQVSEVLSEEKSRLSISGWFHGP
SLTRPPNYFEPPIPRSPHIPQDHEILYDWINPTYLDMDYQVQIQEEFEESSEILLKEFLK
PEKFTKVCEALEHGHVEWSSRGPPNKRFYEKAEESKLPEILKECMKLFRSEALFLLLSNF
TGLKLHFLAPSEEDEMNDKKEAETTDITEEGTSHSPPEPENNQMAISNNSQQSNEQTDPE
PEENETKKESSVPMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEYGGFTS
YIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSFIY
YE
GenBank ID Protein 94536836
UniProtKB/Swiss-Prot ID Q8N543
UniProtKB/Swiss-Prot Entry Name OGFD1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_018233.3
GeneCard ID OGFOD1
GenAtlas ID OGFOD1
HGNC ID HGNC:25585
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Nagase T, Kikuno R, Nakayama M, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Aug 31;7(4):273-81. [PubMed:10997877 ]