Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10683
Secondary Accession Numbers
  • 16942
Name DNA dC->dU-editing enzyme APOBEC-3H
Synonyms
  1. APOBEC-related protein 10
  2. ARP-10
  3. Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H
Gene Name APOBEC3H
Protein Type Enzyme
Biological Properties
General Function Involved in zinc ion binding
Specific Function DNA cytidine deaminase which may provide cellular innate resistance to a specific panel of genetic invaders including endogenous retroelements and a subset of viruses.
Pathways Not Available
Reactions
Cytidine + Water → Uridine + Ammonia details
GO Classification
Biological Process
defense response to virus
DNA cytosine deamination
negative regulation of transposition
negative regulation of retroviral genome replication
Cellular Component
cytoplasm
nucleus
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
transition metal ion binding
zinc ion binding
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
Molecular Function
metal ion binding
cytidine deaminase activity
zinc ion binding
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 22
Locus 22q13.1
SNPs APOBEC3H
Gene Sequence
>603 bp
ATGGCTCTGTTAACAGCCGAAACATTCCGCTTACAGTTTAACAACAAGCGCCGCCTCAGA
AGGCCTTACTACCCGAGGAAGGCCCTCTTGTGTTACCAGCTGACGCCGCAGAATGGCTCC
ACGCCCACGAGAGGCTACTTTGAAAACAAGAAAAAGTGCCATGCAGAAATTTGCTTTATT
AACGAGATCAAGTCCATGGGACTGGACGAAACGCAGTGCTACCAAGTCACCTGTTACCTC
ACGTGGAGCCCCTGCTCCTCCTGTGCCTGGGAGCTGGTTGACTTCATCAAGGCTCACGAC
CATCTGAACCTGGGCATCTTCGCCTCCCGCCTGTACTACCACTGGTGCAAGCCCCAGCAG
AAGGGGCTGCGGCTTCTGTGTGGATCCCAGGTCCCGGTGGAGGTCATGGGCTTCCCAAAG
TTTGCTGACTGCTGGGAAAACTTTGTGGACCACGAGAAACCGCTTTCCTTCAACCCCTAT
AAGATGTTAGAGGAGCTAGATAAAAACAGTCGAGCCATAAAGCGACGGCTTGAGAGGATA
AAGATTCCAGGGGTACGTGCGCAGGGTCGTTACATGGATATATTGTGTGATGCTGAGGTC
TGA
Protein Properties
Number of Residues 200
Molecular Weight 21529.795
Theoretical pI 8.923
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>DNA dC->dU-editing enzyme APOBEC-3H
MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFI
NEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQ
KGLRLLCGSQVPVEVMGFPKFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERI
KIPGVRAQGRYMDILCDAEV
GenBank ID Protein 168984003
UniProtKB/Swiss-Prot ID Q6NTF7
UniProtKB/Swiss-Prot Entry Name ABC3H_HUMAN
PDB IDs Not Available
GenBank Gene ID AL031846
GeneCard ID APOBEC3H
GenAtlas ID APOBEC3H
HGNC ID HGNC:24100
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  4. Wedekind JE, Dance GS, Sowden MP, Smith HC: Messenger RNA editing in mammals: new members of the APOBEC family seeking roles in the family business. Trends Genet. 2003 Apr;19(4):207-16. [PubMed:12683974 ]
  5. OhAinle M, Kerns JA, Malik HS, Emerman M: Adaptive evolution and antiviral activity of the conserved mammalian cytidine deaminase APOBEC3H. J Virol. 2006 Apr;80(8):3853-62. [PubMed:16571802 ]
  6. Dang Y, Wang X, Esselman WJ, Zheng YH: Identification of APOBEC3DE as another antiretroviral factor from the human APOBEC family. J Virol. 2006 Nov;80(21):10522-33. Epub 2006 Aug 18. [PubMed:16920826 ]