| Identification |
|---|
| HMDB Protein ID
| HMDBP10685 |
| Secondary Accession Numbers
| |
| Name
| Dynein light chain 1, cytoplasmic |
| Synonyms
|
- 8 kDa dynein light chain
- DLC8
- Dynein light chain LC8-type 1
- PIN
- Protein inhibitor of neuronal nitric oxide synthase
|
| Gene Name
| DYNLL1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in microtubule-based process |
| Specific Function
| Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Component |
| macromolecular complex |
| protein complex |
| microtubule associated complex |
| Process |
| cellular process |
| microtubule-based process |
|
| Cellular Location
|
- Nucleus
- Cytoplasm
- Mitochondrion
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:1 |
| Locus
| 12q24.23 |
| SNPs
| DYNLL1 |
| Gene Sequence
|
>267 bp
ATGTGCGACCGAAAGGCCGTGATCAAAAATGCGGACATGTCGGAAGAGATGCAACAGGAC
TCGGTGGAGTGCGCTACTCAGGCGCTGGAGAAATACAACATAGAGAAGGACATTGCGGCT
CATATCAAGAAGGAATTTGACAAGAAGTACAATCCCACCTGGCATTGCATCGTGGGGAGG
AACTTCGGTAGTTATGTGACACATGAAACCAAACACTTCATCTACTTCTACCTGGGCCAA
GTGGCCATTCTTCTGTTCAAATCTGGT
|
| Protein Properties |
|---|
| Number of Residues
| 89 |
| Molecular Weight
| 10365.8 |
| Theoretical pI
| 7.5 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Dynein light chain 1, cytoplasmic
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG
|
| External Links |
|---|
| GenBank ID Protein
| 47115281 |
| UniProtKB/Swiss-Prot ID
| P63167 |
| UniProtKB/Swiss-Prot Entry Name
| DYL1_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| CR407672 |
| GeneCard ID
| DYNLL1 |
| GenAtlas ID
| DYNLL1 |
| HGNC ID
| HGNC:15476 |
| References |
|---|
| General References
| - Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
- Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
- Rayala SK, den Hollander P, Balasenthil S, Yang Z, Broaddus RR, Kumar R: Functional regulation of oestrogen receptor pathway by the dynein light chain 1. EMBO Rep. 2005 Jun;6(6):538-44. [PubMed:15891768 ]
- Rayala SK, den Hollander P, Manavathi B, Talukder AH, Song C, Peng S, Barnekow A, Kremerskothen J, Kumar R: Essential role of KIBRA in co-activator function of dynein light chain 1 in mammalian cells. J Biol Chem. 2006 Jul 14;281(28):19092-9. Epub 2006 May 9. [PubMed:16684779 ]
- Dick T, Ray K, Salz HK, Chia W: Cytoplasmic dynein (ddlc1) mutations cause morphogenetic defects and apoptotic cell death in Drosophila melanogaster. Mol Cell Biol. 1996 May;16(5):1966-77. [PubMed:8628263 ]
- Puthalakath H, Huang DC, O'Reilly LA, King SM, Strasser A: The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. Mol Cell. 1999 Mar;3(3):287-96. [PubMed:10198631 ]
- Vadlamudi RK, Bagheri-Yarmand R, Yang Z, Balasenthil S, Nguyen D, Sahin AA, den Hollander P, Kumar R: Dynein light chain 1, a p21-activated kinase 1-interacting substrate, promotes cancerous phenotypes. Cancer Cell. 2004 Jun;5(6):575-85. [PubMed:15193260 ]
- Jeong W, Chang TS, Boja ES, Fales HM, Rhee SG: Roles of TRP14, a thioredoxin-related protein in tumor necrosis factor-alpha signaling pathways. J Biol Chem. 2004 Jan 30;279(5):3151-9. Epub 2003 Nov 7. [PubMed:14607843 ]
- Song C, Wen W, Rayala SK, Chen M, Ma J, Zhang M, Kumar R: Serine 88 phosphorylation of the 8-kDa dynein light chain 1 is a molecular switch for its dimerization status and functions. J Biol Chem. 2008 Feb 15;283(7):4004-13. Epub 2007 Dec 14. [PubMed:18084006 ]
- Lightcap CM, Sun S, Lear JD, Rodeck U, Polenova T, Williams JC: Biochemical and structural characterization of the Pak1-LC8 interaction. J Biol Chem. 2008 Oct 3;283(40):27314-24. doi: 10.1074/jbc.M800758200. Epub 2008 Jul 23. [PubMed:18650427 ]
- Liang J, Jaffrey SR, Guo W, Snyder SH, Clardy J: Structure of the PIN/LC8 dimer with a bound peptide. Nat Struct Biol. 1999 Aug;6(8):735-40. [PubMed:10426949 ]
|
