You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10699
Secondary Accession Numbers
  • 16960
Name N-acetyltransferase 14
Synonyms
  1. K562 cell-derived leucine-zipper-like protein 1
Gene Name NAT14
Protein Type Enzyme
Biological Properties
General Function Involved in N-acetyltransferase activity
Specific Function Probable acetyltransferase that binds the 5'-GGACTACAG- 3' sequence of coproporphyrinogen oxidase promoter. Able to activate transcription of a reporter construct in vitro
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
acetyltransferase activity
n-acetyltransferase activity
Process
metabolic process
Cellular Location
  1. Membrane
  2. Single-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.42
SNPs NAT14
Gene Sequence
>621 bp
ATGGCCCCCAGCCACCTGTCAGTGCGGGAGATGAGGGAAGATGAGAAGCCCCTGGTGCTG
GAGATGCTGAAGGCCGGCGTGAAGGACACGGAAAACCGCGTGGCCCTCCATGCCTTGACA
CGGCCGCCGGCCCTGCTCCTCCTGGCGGCGGCCAGCAGCGGCCTGCGCTTTGTCCTGGCT
TCCTTCGCCCTGGCCCTCCTCCTGCCGGTGTTCCTGGCTGTGGCCGCCGTGAAGCTGGGC
CTGCGGGCCCGATGGGGCTCGCTGCCTCCGCCGGGTGGCCTGGGGGGCCCCTGGGTGGCC
GTGCGGGGCTCCGGTGACGTGTGTGGGGTCCTGGCTCTGGCCCCTGGCACAAATGCAGGG
GACGGGGCCCGGGTCACCCGCCTGTCTGTCTCTCGCTGGCACCGCCGCCGGGGCGTGGGC
AGGAGGCTGCTGGCCTTCGCGGAGGCCCGGGCTCGGGCCTGGGCTGGGGGCATGGGGGAG
CCCCGGGCCCGGCTCGTGGTCCCCGTGGCTGTGGCCGCCTGGGGGGTGGGAGGGATGCTG
GAGGGCTGTGGCTACCAGGTCGAGGGGGGCTGGGGCTGCCTGGGCTACACGCTGGTGAGG
GAATTCAGCAAAGACCTGTGA
Protein Properties
Number of Residues 206
Molecular Weight 21650.2
Theoretical pI 11.32
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 57-77
Protein Sequence
>N-acetyltransferase 14
MAPSHLSVREMREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAAASSGLRFVLA
SFALALLLPVFLAVAAVKLGLRARWGSLPPPGGLGGPWVAVRGSGDVCGVLALAPGTNAG
DGARVTRLSVSRWHRRRGVGRRLLAFAEARARAWAGGMGEPRARLVVPVAVAAWGVGGML
EGCGYQAEGGWGCLGYTLVREFSKDL
GenBank ID Protein 9664094
UniProtKB/Swiss-Prot ID Q8WUY8
UniProtKB/Swiss-Prot Entry Name NAT14_HUMAN
PDB IDs Not Available
GenBank Gene ID AB038651
GeneCard ID NAT14
GenAtlas ID NAT14
HGNC ID HGNC:28918
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Takahashi S, Furuyama K, Kobayashi A, Taketani S, Harigae H, Yamamoto M, Igarashi K, Sasaki T, Hayashi N: Cloning of a coproporphyrinogen oxidase promoter regulatory element binding protein. Biochem Biophys Res Commun. 2000 Jul 5;273(2):596-602. [PubMed:10873651 ]
  3. Takahashi S, Harigae H, Yokoyama H, Kaku M, Sasaki T: Genomic structure and regulation of a novel human gene, Klp1. Biochim Biophys Acta. 2001 Dec 30;1522(3):207-11. [PubMed:11779635 ]